KEGG   Caldicellulosiruptor hydrothermalis: Calhy_0094Help
Entry
Calhy_0094        CDS       T01346                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
chd  Caldicellulosiruptor hydrothermalis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:chd00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:chd00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
126132..127472
Genome map
AA seq 446 aa AA seqDB search
MFKKIACYITAQDQGNPLRQVDNTKECDKIEKESVITIEPSSTFQEVIGFGGALTEAAAV
NILSLLPHQQEEILRRYFDPKEGLGYKLCRIHMNSCDFCVDSYSCDDVEGDSELKYFNIE
RDKKMVIPLLKRIKEYCPDLKILVSPWSPPAWMKTNGDMCHGGKLKDEYKKTWARFFCKF
IKAYKEEGIDIWAVTVQNEPMATQVWESCIYTAEEERDFVKDYLGPTLEEEGLSHIKILI
WDHNKDIIYDRVKTILSDKEAAKYVWGVAFHWYGGDHFDQLKKIKEEFPDVNLVFTEGCQ
EGGVKLGSWELGERYAHEIIGDFNSYTIGFMDWNIVLDTMGGPNHVGNFCDAPIIVDKDQ
KKIYYQNAYYYIGHFSKFIRPGAKVVKSSCSDARLEVLAAKDQDDTLAVVVFNKNPEEIE
FSMVIGEKIFCGKSPARSILTIVLEK
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagaaaattgcatgttacataactgcccaggatcagggtaatcccctgcggcaa
gtagacaatacaaaagagtgtgacaaaatagaaaaggagtctgttataacaattgagcca
tccagtacatttcaagaggtaataggttttggtggagcacttacagaggctgccgcggta
aatatactgtcacttttgccacaccagcaagaagagattttaagaaggtactttgatcca
aaagaggggcttggctacaaactttgtagaattcacatgaacagctgtgatttttgtgtt
gacagttatagctgtgatgatgttgaaggtgatagcgagttaaagtactttaacatcgaa
agagacaaaaagatggtaattcctcttttaaaaaggataaaggaatattgtccagacctc
aaaatcctcgtttcgccatggagtccgcctgcatggatgaaaacaaatggtgatatgtgc
catggtggaaagctaaaagatgagtataaaaaaacatgggcaaggtttttctgcaaattc
ataaaagcatataaagaagaagggattgatatatgggctgtaacagttcaaaatgagccg
atggcaactcaagtgtgggagtcgtgcatatacacagctgaagaagaaagagattttgtg
aaggattacttaggaccaactcttgaagaagaagggctttcccatataaaaatacttata
tgggaccacaacaaagacatcatatatgacagggtaaaaacaattttgagtgacaaagaa
gctgctaagtatgtgtggggagttgcattccactggtatggaggagaccattttgaccag
ctcaaaaaaataaaagaagaatttcctgatgtcaatttggtgtttaccgaaggttgtcag
gaaggtggagtaaagcttggttcctgggagcttggagaaaggtatgctcatgagataatt
ggtgattttaacagttacacaattggatttatggattggaatattgttcttgacacaatg
ggtggacctaatcatgtagggaacttttgcgacgctccaataatagttgataaagaccag
aaaaagatttactatcaaaatgcatattattatatagggcatttttctaaattcataagg
ccgggagctaaagtagtcaaaagtagctgcagtgatgcaagacttgaagttttggcagcg
aaggaccaggacgatactttagcagtggttgtctttaataaaaacccagaggaaatagag
tttagtatggttattggagagaaaatattctgtggaaagtctccagcaaggtctatattg
accattgttctggaaaagtaa

DBGET integrated database retrieval system