KEGG   Caldicellulosiruptor hydrothermalis: Calhy_0125Help
Entry
Calhy_0125        CDS       T01346                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
chd  Caldicellulosiruptor hydrothermalis
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Calhy_0125
   00500 Starch and sucrose metabolism
    Calhy_0125
Enzymes [BR:chd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Calhy_0125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
163347..164552
Genome map
AA seq 401 aa AA seqDB search
MFSLKSYLPDATLSKYVKVSVKADENIFVKMSLNKELLIERFLREDEILDAVVKLNEGKN
HLQIEGENLEGNKYVLNKSIRYLEKPFAIVDQNYAGCDKDVAGGIVFCKSLKSLTEILKK
ENSSYKAVFIRNGIYREKVNIDSSRVMLIGEDRNKTIVTYSLAAGLPAENGGILSTSNTA
TFTISGEDFVVENITFENGFDRNVPIEHRQAVAVKALADRLMFFNCAFKSTQDTLYADFG
RQYYYRCYIEGDVDFIFGAATAVFEECVICSLDREDRKIKGYVTAASTKPDSQYGFLFIR
CKLISNIREKECVYLGRPWHPSSDPNRWANVVFRECYLDEHIHTDGWCEMHGFCPENERF
FEYKNFGPGSGKQNPKRPQLDEMEAEMYTREKVLGEWKVEI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgttttctttaaagagctaccttcccgatgctactttgtccaaatatgtgaaggtttcg
gtcaaggcagatgaaaatatttttgtgaagatgtcgctcaacaaagaactgctaatagaa
agatttctcagagaagatgagattttagacgcggttgttaagctgaatgaaggaaaaaac
cacttgcagattgaaggtgaaaatcttgaaggcaacaagtatgttttgaataaaagtata
agatatctggaaaaaccgtttgcaatagttgaccaaaactatgcggggtgtgacaaagat
gttgcaggtggcatagttttttgcaaaagtttaaaaagcttgaccgaaatccttaaaaaa
gaaaactcttcatataaagctgtgtttataagaaatggaatttatagagaaaaagtaaat
attgattcgtcaagggtaatgctgattggtgaggacagaaacaaaaccattgtgacttat
tctttggcagcaggacttcccgcagaaaatggagggattttatctacctcaaacactgct
acatttacaatatctggagaggattttgttgttgaaaatattacatttgaaaatggtttt
gatagaaatgttccgattgagcacagacaggctgttgcagtaaaggcgttggctgacagg
ttaatgtttttcaactgcgcctttaaaagtactcaggacactctttatgctgattttggg
agacagtattattatagatgctacatagagggagatgtagatttcatttttggagcagca
acagctgtcttcgaagaatgtgtgatatgttctcttgacagggaagacagaaaaataaaa
gggtatgttacagcagcaagtacaaaaccagatagccagtatgggttcttattcataaga
tgcaagcttatatccaatataagagaaaaagagtgtgtctaccttggaagaccatggcat
ccatcttctgatcctaacaggtgggcaaatgttgtgttcagagaatgttatttggacgaa
catattcacactgatggctggtgtgagatgcatggcttttgcccagaaaatgaaagattt
tttgagtataaaaattttggtccaggtagcggcaaacaaaatcccaaaagacctcaactt
gatgaaatggaagctgagatgtatacaagggaaaaggttttaggagagtggaaagtagag
atatag

DBGET integrated database retrieval system