KEGG   Caldicellulosiruptor hydrothermalis: Calhy_0169Help
Entry
Calhy_0169        CDS       T01346                                 

Definition
glycoside hydrolase family 4
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
chd  Caldicellulosiruptor hydrothermalis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:chd00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:chd00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:chd00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
218541..219941
Genome map
AA seq 466 aa AA seqDB search
MKISIVGAGSVRYSLQLIGDIAKIPELSGVNVTLMDINNQRLDAIYILAKKYIEELGANI
SIEKTLSLEEAVKGADFIINTALPYPPEHEDGFEKYEIITQVAEKYGYYRGIDSQEFNMV
STYSYMICSYFDLKLALQISELMEKYSPNAWLLQTANPIFEITQYLTRYTNTKIIGFCHG
YGGIYEVFETLGMDKNEVDWQVSGVNHGIWLNRFKYKGEDGYKLLDKWIEEGLPNWESKN
PWDLQLSPAAIDMYKFYGMLPIGDTVRNGSWKYHYNLETKKKWHGKFGGIDNEVERPKFH
RQLRASKQRLIELAKKVEADSNCSLTVELPELFTTDRMSGEQQILFINALINDKRTRLVL
NIPNRGVISGIPDDVVVEVTCQVDAQGIHPEKVEPDLTDRIKKFYLVPRIMRMEMALEAF
RTRDIKVLEEFLIRDPRTRSYEQVKNVLRELLELPFNREIKEYFGV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatcaattgtaggtgcaggaagtgtaagatattctctgcaactaataggagat
attgcaaagattccagaactatcaggtgttaatgtgactctaatggatatcaataatcaa
cgattagatgcaatttacatccttgccaaaaaatacattgaagaacttggtgcaaatatt
tctatagagaaaacattatctttagaagaagcagtaaaaggcgcagatttcattataaac
acggctttgccttatcctccagagcatgaagatggatttgaaaaatatgagattattact
caagttgcagaaaaatatggatattacagaggtattgatagccaagagtttaatatggtt
tcaacttattcttatatgatttgcagttattttgatttaaaacttgcattgcaaatttca
gaattaatggaaaagtactctccgaatgcttggctcttgcaaactgcaaatccgatattt
gaaataacacagtatttaactcgatacacaaatacaaaaataatcggattttgtcatggg
tatggaggtatatatgaggtatttgaaacccttggtatggacaaaaacgaggtggattgg
caggtttctggtgtaaatcatggcatttggctcaataggttcaagtataaaggtgaagat
ggctacaaattattagataagtggattgaagaaggacttccaaattgggaatccaaaaat
ccatgggatctgcaactaagtcctgcagcgatagacatgtacaaattctatggtatgctt
ccaataggcgatacagtccgcaatggttcttggaaataccattacaatttggaaactaaa
aagaaatggcatggcaagtttggaggaattgataatgaagtagaaaggccaaaattccac
agacagctcagagcaagcaaacaaaggcttatagaacttgcaaagaaagtagaagctgac
tcaaactgttctttaacagttgagcttccagagctgtttacaacagacagaatgagtggt
gaacaacagattctctttataaatgcattgataaatgataaaagaacaagacttgtttta
aatattcctaacagaggcgtaatttcaggaattcctgatgatgttgtagttgaagtaacc
tgtcaggtagatgctcaaggaattcacccagaaaaagtggaacctgacctaactgataga
ataaagaaattttatttagttccaagaataatgagaatggaaatggctttagaagctttt
aggacaagagatataaaagtgcttgaagagtttttaataagagatccaagaacacgttca
tatgaacaggtaaaaaatgttttgagagagttactcgaacttccttttaacagagagatt
aaagaatattttggtgtataa

DBGET integrated database retrieval system