KEGG   Caldicellulosiruptor hydrothermalis: Calhy_0264Help
Entry
Calhy_0264        CDS       T01346                                 

Definition
class ii aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
chd  Caldicellulosiruptor hydrothermalis
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:chd00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Calhy_0264
Enzymes [BR:chd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Calhy_0264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(322391..323032)
Genome map
AA seq 213 aa AA seqDB search
MQDIRSIKSQICRIGRIMYERGYISGPDGNISVRVDQDKIITTPSGVSKGFLNEDMLVLI
DMEGKILEKSNYKPSSEIKMHLKVYQEREDIGACVHAHSPYATTFAVLRKPLDKPILAES
VFIFGGYIPVAPFATPSTVEVPQSIAPYVKDYDAVLLSNHGVLTYDKDLEMAFYKLEIVE
FWAKILFLSSQIGTPQVLSPEEIQKVLDLRKGK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatataagaagcatcaaatcacagatatgcaggattggaagaatcatgtacgaa
agaggttatataagcggacctgacggaaatatctctgtaagagtcgaccaggataagatc
atcacaacaccgtcgggtgtgtcgaaaggttttttgaatgaagacatgctggttttaatt
gacatggaaggtaaaattcttgaaaagtcaaattacaagccatcgtctgagataaagatg
caccttaaagtttatcaagaaagagaggacataggtgcctgtgttcatgcacactcacct
tatgcaaccacatttgcagttttaagaaagcctcttgacaagccaattttagcagagtca
gtcttcatctttggcgggtatatccctgttgcgccgtttgcgacaccttcaacagttgag
gtgccccagtcaatcgcaccttatgtaaaagactacgatgctgtgcttctttcaaaccat
ggcgttttgacatacgacaaggacttggagatggcattttacaagcttgagattgttgag
ttttgggcaaagattttatttctatcaagccagataggcacaccgcaagttttgagccct
gaggaaattcaaaaggttttggatttgagaaaaggtaagtga

DBGET integrated database retrieval system