KEGG   Caldicellulosiruptor hydrothermalis: Calhy_0521Help
Entry
Calhy_0521        CDS       T01346                                 

Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
chd  Caldicellulosiruptor hydrothermalis
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:chd00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Calhy_0521
Enzymes [BR:chd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Calhy_0521
Amino acid related enzymes [BR:chd01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Calhy_0521
Transfer RNA biogenesis [BR:chd03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Calhy_0521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
571040..572497
Genome map
AA seq 485 aa AA seqDB search
MEVRTRFAPSPTGHLHIGGARTALFNYLFAKRYGGKFILRIEDTDLERSSIESEKVIIES
LRWLGIEWDEGVEVGGPYGPYRSTERVDIYKKYVDVLFEKGYAYYCYCTEEELEAQRQEL
LSKGQMPRYTGKCRNLTDEEKRKLEAEGRKPTVRFKVPEGVKIVVHDLVRGDVEFLSDDI
GDFVIVKSDGIPTYNFAVVIDDHLMKISHVIRGEEHLSNTPRQILIYNALGFELPQFAHV
SLILGKDRTKMSKRHGSTWVEQYKEQGYLKEGLINFLALLGWSPPEDKEIFDMEYLIENF
SLERVSKNPAIFDIDKLNYINSQHIKLKSLDELTQMCIPYFVEAGYIKEDEAQSKFEWLK
KIVKSVYEGLDYLSQIKDRVDIFFNNEVKIEEDEAKEVLKWEHVKDLINVFENKVTQLSE
LTPEAIKLLFKEIQKETGYKGKNLFMPIRVVLTGKTHGPELVEIIEIVGKENILKRLEFF
KTWYN
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
gtggaagtaagaacaagatttgcaccaagcccaacagggcaccttcacattggcggtgca
agaacagcacttttcaactacctttttgccaaaagatatggtggaaagtttatattaagg
atagaagacacagacttagaaagatcgtctattgagtccgaaaaggttatcatcgaaagc
ttgagatggcttgggattgagtgggatgaaggtgttgaggtagggggaccttatgggcct
tatagatcaacagaaagagtggatatttacaaaaaatatgttgatgttctttttgaaaaa
ggctacgcatactattgttactgcacagaagaggagcttgaggctcaaagacaagagctt
ttatcaaaaggtcagatgccaaggtatacaggaaagtgcagaaatctcactgatgaagaa
aagagaaagcttgaggcagaaggaagaaaacctactgtgagatttaaagtgccagaaggt
gtgaaaatagttgttcatgatttggtaagaggcgatgttgagtttttgagtgatgacata
ggcgactttgtaattgtcaaatctgatggaattcccacatataactttgcagttgtcata
gatgaccacttaatgaagatttcgcatgttataagaggtgaagagcatctttcaaacact
ccgcgacagattctaatttacaatgcgcttgggtttgaacttccgcagtttgctcatgtt
tcgcttatacttggaaaagacagaacaaagatgtcaaagcgccacggctctacttgggtt
gagcagtacaaagagcaagggtatttaaaagaaggacttataaacttcttggctctgctt
ggttggtcaccaccagaggataaagaaatatttgacatggagtatctaattgagaatttc
tcattagaaagagtttccaaaaatcctgcaatatttgacatcgataagctaaattatata
aactctcagcacattaaactaaaatcattggatgaacttacccagatgtgcataccgtac
tttgttgaagcaggatatatcaaagaggatgaggcacagtccaaatttgaatggctcaag
aagatagtaaaatctgtgtatgaaggactggattatctatctcagatcaaagacagggtt
gatatcttctttaacaatgaagtcaaaatagaagaagatgaggcaaaagaggtcttaaaa
tgggagcatgtgaaagatttaataaatgtctttgagaataaagtaactcagctcagtgaa
ttgacacctgaagctattaagctacttttcaaagagattcaaaaagagacaggttacaag
ggcaaaaacctatttatgccgataagagttgtgttgactggcaaaactcacggacccgag
cttgtggagataatagagattgtgggtaaagaaaacatactaaaacgattggaattcttc
aaaacgtggtataattaa

DBGET integrated database retrieval system