KEGG   Caldicellulosiruptor hydrothermalis: Calhy_0667Help
Entry
Calhy_0667        CDS       T01346                                 

Definition
glycoside hydrolase family 35
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
chd  Caldicellulosiruptor hydrothermalis
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:chd00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
717614..720373
Genome map
AA seq 919 aa AA seqDB search
MDTKKYVELDEQGIKIGNEYKILLCSSLFYFRIPKAEWEDRIRKIKMAGYNCLDVYFPWN
YHEEEEGKWNFEGEKNVEGFLEIVKKYKMYVIARPGPYICSEWDLGGLPAYLLTKEGIRL
RDENAVYLSYVEKWFDKIMPIIHKYQLTEEGTIIAVQIENELDFYNCKNRKGYMKSLLEL
TKKYNIEVPIVACAGQGDIEGATGLVEGIVPTFNFYPSIKDPSIEAKIYYYLDYVRRKNL
PLLITETGREHFLLKRLLASGAKLIGAYNQVGGTNFEFYNAVNNWGEPLSLIACDYDFNS
LISAFGEINEKEFVEARVLSKIINSLGELIAASSIEINNSVEVEIEKGELCPITRIINLN
GYGKMASLVNVADGDAVVKIKMKNDLLPYESELSVRPLACRYVFLDLDLKKWGINGKILF
SSAEPCFIDAISDETVMVFYTPDEKSEITLVIEEIEKIEGDVDVSNVVTFRFKKEESGRS
ITIVLKNGKKLKLIGLDKISAAKLEGIDENGNLIYLENFENQAIVAGENLRSVRVTFENR
LNELLYAQKVAENHKPVFLEQAGIERGWGWYDLKFNTTNTDEFKGIVIDNASDILSMFVD
KHFLGTFINGGDYLYIDSPLKVEGKEIEIFIKSEIWGHCNFDDIRKKSLRLHSLKGLSDV
SLIKDVIDITQNWYLYKDTNFDHPPIYTNFGSRLNSNKGFKDCYYKEIFVDENTETLYLW
FKNFQCRGVLYINDKCVGEIDKYYQFFNVTEYIKKGSINNIKVIVEKNYYDETAGKVYML
KGIKSRECTISGLSAHNLYKLSIDAKERSNELALPLVLGEDNSAIVYIEPSYKDAYKKIK
AIFKGENIKITAITQNKVIGRIWTDEMINKSFLRGGKPDVLYIPKERLDENNSNFILYLE
KIRKGQKGILHAIELKFMR
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atggacaccaaaaaatacgttgaacttgatgagcaggggatcaaaatagggaatgaatat
aaaatcttgttatgttcttcactcttttattttcgcattcctaaagccgaatgggaagac
agaataagaaaaataaaaatggcaggctataattgcttggatgtatatttcccgtggaat
tatcatgaggaagaagaaggaaaatggaattttgaaggagaaaaaaacgttgaaggattt
ttagaaatagttaaaaaatacaaaatgtatgtgattgcaagaccagggccttatatatgt
tcagagtgggacttaggtgggctacctgcatatttactcacaaaagaaggtattcggttg
agagatgaaaatgcagtttatttgagttatgtagagaaatggtttgataaaataatgccg
ataatacataagtatcagttgacagaagaaggaactataattgcagttcaaatagaaaat
gaattagatttttacaattgcaaaaatagaaaaggttatatgaagagtttattggagctt
acaaaaaagtacaatatagaagtaccaatagttgcttgtgcaggccagggagatatagaa
ggagcaaccggtcttgtagaaggtattgttcctacgtttaatttttatccctctataaaa
gacccttctattgaggcaaaaatatattattatcttgattatgtcagaagaaaaaatcta
ccactcttaattactgaaacaggaagagaacatttcttgctaaagagacttttagcaagc
ggagctaaacttataggagcttataatcaagtcggtggtacaaactttgaattttacaat
gcagtgaataactggggagaaccactttcattaatagcatgcgattatgatttcaattct
cttatttcagctttcggagaaattaatgaaaaggaatttgtagaggcacgggtattgagt
aaaataataaattccttaggtgagttaattgctgcctcaagtatagaaattaacaattca
gttgaagtggaaattgaaaaaggggaattatgtccaattacaaggataattaacctaaat
ggatatggaaaaatggcttcattggtaaatgttgcagacggagatgcagttgtaaaaata
aaaatgaaaaatgatttattgccatatgaatctgaattgtcggtaagaccacttgcatgc
cggtatgtatttttagatctggatcttaaaaaatggggaataaacggaaaaatacttttt
tcttcagctgagccatgctttattgacgctataagtgatgaaacggtaatggtgttctac
acacctgatgaaaaaagcgaaataacattagtgattgaggaaatagagaagatagaagga
gatgttgatgtttcaaacgtggtaacttttagatttaagaaagaagagagtggaagatca
attacaattgtactgaaaaatgggaaaaagttaaaattaataggtcttgataagataagt
gctgcaaaacttgaaggtattgatgaaaatgggaatttgatttatcttgagaattttgaa
aatcaagctatagttgctggagaaaatttgagaagtgtcagggtcacgtttgagaataga
ttaaatgaacttttatatgctcaaaaagtggcagagaatcataagcctgtgtttttagaa
caggctggtatagaaagaggatggggatggtatgatttaaaatttaacacaacaaataca
gatgaatttaaagggattgtgatagataacgcaagtgacattttatcaatgtttgtggat
aagcattttttaggcacttttataaatggaggagattacttgtatatagactcaccgctt
aaagtagagggtaaggagatagaaattttcattaaatcagagatatggggccattgcaat
tttgatgatattagaaaaaaatcgcttagattgcattctttaaagggcttaagtgatgta
agtttaatcaaggatgtgatagatattactcaaaactggtatctctataaggatacaaat
ttcgaccatccaccaatctatactaacttcggaagcagattgaattctaataaaggcttt
aaagattgttattataaagagatttttgtagatgaaaatactgaaactttatacctttgg
ttcaaaaactttcaatgcagaggagtactttatatcaatgataaatgtgtgggggaaata
gataaatactatcaatttttcaatgtcactgagtatatcaaaaaaggttcaattaacaac
ataaaagtgattgtagaaaaaaactattatgatgagactgcagggaaagtttatatgctg
aagggaataaagagtagagaatgcacaatttcaggtttatctgctcataatttatataag
ttaagtatagatgcaaaagaaagatcaaatgaacttgctttaccacttgtgttaggtgaa
gataattcggccatagtttacattgaaccttcttataaagatgcctataaaaagattaag
gctatttttaaaggagaaaacataaagattacagcaattacccaaaataaagttattggg
agaatatggactgatgagatgattaacaaatcctttttaagagggggaaaacccgatgtt
ttatacatacctaaggagagattagatgaaaataatagtaattttatactatatttagag
aaaataagaaagggacaaaaaggaatattacacgctatagaacttaaatttatgcgataa

DBGET integrated database retrieval system