KEGG   Caldicellulosiruptor hydrothermalis: Calhy_0677Help
Entry
Calhy_0677        CDS       T01346                                 

Definition
l-fucose isomerase (EC:5.3.1.25)
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
chd  Caldicellulosiruptor hydrothermalis
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:chd00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Calhy_0677
Enzymes [BR:chd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     Calhy_0677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
731358..733172
Genome map
AA seq 604 aa AA seqDB search
MSNERLNVFIGEKRFVEDYPKVGIRPTIDGRYGGVRESLEEQTWRLAKSVAEFIEKNVYL
PNGEKVKCVLPPRCIGGVVEARMADELFKKEGVGVSITVTPCWCYGSETMDMTLDIPKAV
WGFNGTERPGAVYLAAVSAAHNQKGLPVFKIYGKDVQDRDDFSIPKDVQEKILKFVKSAL
AVSIMKNKSYLSIGSVSMGIAGSIVDPDFFEDYLGMRVEYVDMSEIIRRIEEKIYDQEEF
ERAMQWIKNNCREGEDPNPPEKRVDRKKKDEVWEFVVKMGIITRDLMVGNKKLEALGYPE
ESLGHNAILAGFQGQRQWTDHFPNGDFMETILNSSFDWNGLRQPYILATENDSLNGVCML
FGHLLTNTAQIFADVRTYWSSSAIYRVTGWKPEGLLEDGVIHLINSGSAALDGTGQQEID
GKPAIKPFWEITEQEVKKCLDATRFCYANLGYFRGGGFSTKFVTRGGMPVTISRLNIVKG
LGPVLQIAEGWTVELPANVHEILDRRTDPTWPTTWFVPKLTGKGVFKSVYSVMENWGANH
CAITYGHVGDLFITLASMLRIPVCMHNVEEERIFRPSAWSAFGTEDLEGADFRACKNFGP
LYKK
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatgaaagattaaatgtttttataggtgaaaaaagatttgttgaagattacccc
aaggtaggtataagaccaactatagatggaagatatggtggagtaagagaatccttagaa
gagcagacatggagattagcaaaatcagtggcagagtttatagaaaagaacgtttattta
ccaaatggtgagaaggtaaagtgtgtacttccacctcgatgtattggtggtgttgttgag
gcaagaatggcagatgaactttttaagaaagaaggagtaggggtttccataacagtcaca
ccttgttggtgttatggatctgaaacaatggacatgacattggatattccaaaagctgta
tggggatttaatggcacagaaagaccgggtgctgtgtatcttgcagctgtatctgctgct
cacaaccaaaaaggacttcctgtctttaaaatctatggcaaggatgttcaagacagagac
gacttttcaattcctaaggatgtccaagaaaagattttaaagtttgtaaaaagtgcttta
gcagtttctataatgaaaaataagtcttatctttcaattgggagcgtatcgatgggaatt
gcaggttctattgttgaccctgacttttttgaggattatcttgggatgagagttgagtat
gttgacatgtccgaaataataaggcggatagaagaaaagatatacgaccaagaagaattt
gaaagggcaatgcagtggataaaaaataattgtagggaaggagaagaccctaatccaccg
gagaaaagagttgacagaaaaaagaaggatgaagtatgggaatttgtagttaagatgggt
ataataacaagagatttgatggttggaaataaaaaacttgaagcattaggatacccagaa
gaaagccttggtcacaatgcaattttggcaggatttcaagggcagcgtcaatggacagac
cacttcccaaacggtgactttatggaaacaattctaaactcctcatttgactggaatgga
cttagacagccttacatacttgcaactgaaaatgacagcttaaacggtgtatgtatgtta
tttggacatttacttacaaatacagctcagatttttgcagatgttcgaacatattggagc
agtagcgctatttatagagttacaggttggaagccagaaggactccttgaggatggtgtt
atccatctaatcaactctggttctgcagcactggatggaacaggtcagcaagagattgac
ggcaagcctgcgataaaacctttctgggagattaccgagcaagaagttaaaaagtgctta
gacgcaacaagattttgttatgctaatttgggatattttagaggtggtggattttcaaca
aagtttgtaacaagaggcggcatgcctgttacaatctcaagattaaatattgttaaaggt
ttagggccagtccttcaaattgcagaaggctggacagtagaacttcctgcaaatgttcat
gaaatacttgacagaagaacagacccgacatggccgaccacatggtttgtaccaaaacta
actggcaagggagtatttaagagcgtatattctgtgatggaaaactggggagcaaatcac
tgtgcaataacgtatgggcatgtgggtgatttgtttatcacattggcatcaatgttaaga
attccagtttgtatgcataatgttgaagaggagagaatattcagaccaagtgcatggagt
gcatttggcacagaagatttggaaggagcagattttagagcatgcaaaaattttggccca
ctttataagaagtga

DBGET integrated database retrieval system