KEGG   Caldicellulosiruptor hydrothermalis: Calhy_0677Help
Entry
Calhy_0677        CDS       T01346                                 

Definition
l-fucose isomerase (EC:5.3.1.25)
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
chd  Caldicellulosiruptor hydrothermalis
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:chd00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
731358..733172
Genome map
AA seq 604 aa AA seqDB search
MSNERLNVFIGEKRFVEDYPKVGIRPTIDGRYGGVRESLEEQTWRLAKSVAEFIEKNVYL
PNGEKVKCVLPPRCIGGVVEARMADELFKKEGVGVSITVTPCWCYGSETMDMTLDIPKAV
WGFNGTERPGAVYLAAVSAAHNQKGLPVFKIYGKDVQDRDDFSIPKDVQEKILKFVKSAL
AVSIMKNKSYLSIGSVSMGIAGSIVDPDFFEDYLGMRVEYVDMSEIIRRIEEKIYDQEEF
ERAMQWIKNNCREGEDPNPPEKRVDRKKKDEVWEFVVKMGIITRDLMVGNKKLEALGYPE
ESLGHNAILAGFQGQRQWTDHFPNGDFMETILNSSFDWNGLRQPYILATENDSLNGVCML
FGHLLTNTAQIFADVRTYWSSSAIYRVTGWKPEGLLEDGVIHLINSGSAALDGTGQQEID
GKPAIKPFWEITEQEVKKCLDATRFCYANLGYFRGGGFSTKFVTRGGMPVTISRLNIVKG
LGPVLQIAEGWTVELPANVHEILDRRTDPTWPTTWFVPKLTGKGVFKSVYSVMENWGANH
CAITYGHVGDLFITLASMLRIPVCMHNVEEERIFRPSAWSAFGTEDLEGADFRACKNFGP
LYKK
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatgaaagattaaatgtttttataggtgaaaaaagatttgttgaagattacccc
aaggtaggtataagaccaactatagatggaagatatggtggagtaagagaatccttagaa
gagcagacatggagattagcaaaatcagtggcagagtttatagaaaagaacgtttattta
ccaaatggtgagaaggtaaagtgtgtacttccacctcgatgtattggtggtgttgttgag
gcaagaatggcagatgaactttttaagaaagaaggagtaggggtttccataacagtcaca
ccttgttggtgttatggatctgaaacaatggacatgacattggatattccaaaagctgta
tggggatttaatggcacagaaagaccgggtgctgtgtatcttgcagctgtatctgctgct
cacaaccaaaaaggacttcctgtctttaaaatctatggcaaggatgttcaagacagagac
gacttttcaattcctaaggatgtccaagaaaagattttaaagtttgtaaaaagtgcttta
gcagtttctataatgaaaaataagtcttatctttcaattgggagcgtatcgatgggaatt
gcaggttctattgttgaccctgacttttttgaggattatcttgggatgagagttgagtat
gttgacatgtccgaaataataaggcggatagaagaaaagatatacgaccaagaagaattt
gaaagggcaatgcagtggataaaaaataattgtagggaaggagaagaccctaatccaccg
gagaaaagagttgacagaaaaaagaaggatgaagtatgggaatttgtagttaagatgggt
ataataacaagagatttgatggttggaaataaaaaacttgaagcattaggatacccagaa
gaaagccttggtcacaatgcaattttggcaggatttcaagggcagcgtcaatggacagac
cacttcccaaacggtgactttatggaaacaattctaaactcctcatttgactggaatgga
cttagacagccttacatacttgcaactgaaaatgacagcttaaacggtgtatgtatgtta
tttggacatttacttacaaatacagctcagatttttgcagatgttcgaacatattggagc
agtagcgctatttatagagttacaggttggaagccagaaggactccttgaggatggtgtt
atccatctaatcaactctggttctgcagcactggatggaacaggtcagcaagagattgac
ggcaagcctgcgataaaacctttctgggagattaccgagcaagaagttaaaaagtgctta
gacgcaacaagattttgttatgctaatttgggatattttagaggtggtggattttcaaca
aagtttgtaacaagaggcggcatgcctgttacaatctcaagattaaatattgttaaaggt
ttagggccagtccttcaaattgcagaaggctggacagtagaacttcctgcaaatgttcat
gaaatacttgacagaagaacagacccgacatggccgaccacatggtttgtaccaaaacta
actggcaagggagtatttaagagcgtatattctgtgatggaaaactggggagcaaatcac
tgtgcaataacgtatgggcatgtgggtgatttgtttatcacattggcatcaatgttaaga
attccagtttgtatgcataatgttgaagaggagagaatattcagaccaagtgcatggagt
gcatttggcacagaagatttggaaggagcagattttagagcatgcaaaaattttggccca
ctttataagaagtga

DBGET integrated database retrieval system