KEGG   Caldicellulosiruptor hydrothermalis: Calhy_0923Help
Entry
Calhy_0923        CDS       T01346                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
chd  Caldicellulosiruptor hydrothermalis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:chd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Calhy_0923
   01230 Biosynthesis of amino acids
    Calhy_0923
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calhy_0923
   00030 Pentose phosphate pathway
    Calhy_0923
   00051 Fructose and mannose metabolism
    Calhy_0923
   00052 Galactose metabolism
    Calhy_0923
  Energy metabolism
   00680 Methane metabolism
    Calhy_0923
Enzymes [BR:chd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Calhy_0923
Protein phosphatases and associated proteins [BR:chd01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Calhy_0923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(958915..960162)
Genome map
AA seq 415 aa AA seqDB search
MPKEGNCVVAQSGGPTAVINASLLGVIEEAMKQHPIRAIYGAKNGIIGLIDEELYDLRME
DPEELKLLKTTPSSALGSCRYQLKPFEHDEKDYIKIFNVFEAHNIRYFFYIGGNDSMDTA
DKLTRYAQKIGYDICIIGIPKTIDNDLVMTDHCPGFGSAAKYIATSVMEIARDAVVYPTN
IVTIIEVMGRNAGWLAAASALASKDIGAPDLIYLPEVPFSIDKFLDDVRNIHKKTGKITI
VVSEGIKDKEGKYIADMSHKFGIDAFGHVQLGGAAFVLENIIREEVEKRVKSIQFNVLQR
SAAHIMSKTDVEEAYMVGRMAVRYAVEGACGYMVAIKRDSDNPYSSSTELVELNKVANAE
KLVPLAWISHDGNYVKEDALNYIQPLIEGEVEVKYERGLPRYAKLRKIMVPKKVV
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaagaaggtaactgcgtggttgcgcaatcaggtggaccaactgctgtcatcaac
gcatcgcttctgggtgttattgaagaagctatgaaacagcacccaatccgtgctatttat
ggtgctaaaaatggaatcattggtcttattgatgaagagctttacgacctcagaatggaa
gaccctgaagagttaaaacttttaaagacaactccatcctctgctttaggttcttgcagg
tatcagctcaagccttttgaacatgatgaaaaagactatatcaagattttcaatgtattt
gaggcgcacaacatccgctactttttctatataggcggaaatgactcaatggacacagct
gacaagctcacacgatatgcacaaaaaattgggtatgacatttgcataattggaattcca
aagacaattgacaatgaccttgtgatgacagaccactgcccgggttttggaagtgctgca
aagtacattgcaacatctgtgatggagattgcaagagatgcagtggtgtacccaacaaac
attgttactataattgaagtgatgggaagaaacgctggctggcttgcagcagcatctgca
ctggcatccaaagatataggcgcaccagatttaatataccttcctgaagttccattttca
attgacaagtttttggatgatgtaagaaatatccacaaaaaaactggaaagatcactatt
gtggtttcagagggcataaaagacaaagaaggaaagtatattgctgatatgagccacaag
tttggaatagacgcgtttggacatgtacagcttggcggagcagcatttgttttagagaac
atcatccgcgaagaagtggaaaagagagtaaaatcaattcaattcaacgtactgcagcgc
agtgctgctcatatcatgtccaaaactgatgttgaagaagcgtacatggttggacgtatg
gcagtaaggtacgcggttgaaggcgcttgtggatacatggtagcaataaaacgcgacagt
gacaatccttattcaagttcgacagaacttgttgagctgaacaaggttgcaaacgctgaa
aagcttgtcccacttgcatggatctcacatgacggcaactatgtaaaagaagatgctcta
aattatatccaaccgctcattgaaggtgaagttgaagtcaagtacgaaagaggtcttcct
cgatatgcaaagctcagaaagataatggtgccaaagaaggttgtataa

DBGET integrated database retrieval system