KEGG   Caldicellulosiruptor hydrothermalis: Calhy_1058Help
Entry
Calhy_1058        CDS       T01346                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
chd  Caldicellulosiruptor hydrothermalis
Pathway
chd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
chd01100  Metabolic pathways
chd01110  Biosynthesis of secondary metabolites
chd01130  Biosynthesis of antibiotics
chd01230  Biosynthesis of amino acids
Module
chd_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:chd00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Calhy_1058
Enzymes [BR:chd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Calhy_1058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth FMN_dh ThiG QRPTase_C NMO
Motif
Other DBs
NCBI-ProteinID: ADQ06785
UniProt: E4Q869
Position
1078147..1078929
Genome map
AA seq 260 aa AA seqDB search
MSVLERILSYKKEEVEKCKNLIPVEKMKKLAVEKIKGGYLENKFKRIFKKDKFCIIGEIK
RASPSEGVISEDANAKAIAKMYEDLGFFAISVLTERFFFKGSEQDLMEVKKEVSLPVLRK
DFIIDIWQLYQTKMIGADAALLITKALSEKQLAIFIKILEILDIVPLVEVENEYEIEKAL
KCGAKLIGINNRNLDDLSIDITKTERLLKYIPKEVAVISESGIKTKEDFDYILSLGVDGC
LIGTSFMKSQNPLEIIGDRI
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgcttgagcgtattttaagttataaaaaggaagaggttgaaaagtgcaaaaat
ctcatacctgttgagaaaatgaagaaacttgcagttgagaagattaaaggtggctattta
gaaaacaagttcaaaagaatattcaaaaaagataaattctgtataattggtgaaataaaa
cgggcatcaccttcggagggcgtaatatcagaggatgccaatgcaaaagcaatagcaaag
atgtacgaagatttgggattttttgctatatcagttttgacagaaagattttttttcaag
ggttcggagcaagatttgatggaagtaaaaaaagaggtatctctgcccgtgctaagaaaa
gactttatcattgatatctggcagctttaccagacaaagatgataggcgcagatgcagct
ttgcttatcacaaaagctttgtcagaaaaacagcttgcaatattcatcaaaattttagaa
attcttgacattgtcccgcttgttgaggttgaaaatgagtatgaaattgaaaaagctttg
aagtgtggtgcaaaactcataggaatcaacaatagaaacctggatgatttgtccatcgac
ataacaaaaacagaaaggcttttgaagtatattccaaaagaagttgctgtgataagcgaa
agtggaattaagacaaaagaggattttgactatattctctcgctcggtgttgatggatgt
ttgatagggacatcttttatgaaatcgcaaaatccgcttgaaataattggtgataggata
tga

DBGET integrated database retrieval system