KEGG   Caldicellulosiruptor hydrothermalis: Calhy_1060Help
Entry
Calhy_1060        CDS       T01346                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
chd  Caldicellulosiruptor hydrothermalis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:chd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Calhy_1060
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Calhy_1060
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Calhy_1060
Enzymes [BR:chd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Calhy_1060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1079533..1080714
Genome map
AA seq 393 aa AA seqDB search
MDRYFGRFGGMYAPETLMPALLEIEEEFCKLVKDENFLSEYEYYLKNYVGRPSPLYFAKN
LSNHLGVKIYLKREDLNHTGAHKINNCIGQALLAKHMGKKRLIAETGAGQHGVATSTVAA
LFGMECEIFMGEEDAKRQFHNVQRMKMLGSKVRVVNKGSKTLKDAINEAMRDWSETFEYT
FYLFGTAAGPHPFPTIVKYFQSVIGKETKDQIKRLEGRLPDYIFACVGGGSNAIGIFSAF
LEDHEVKLIGVEGAGEGIHTGKTAATLCSGSVGILHGAKTYILQDEEGQIQNTHSISAGL
DYPGVGPEHAYLKETGRVEYVGATDKEAVDAFLLLTRLEGIIPALESSHALAEVIKRAKM
GLFKTSDIVVVNLSGRGDKDINTVLELWKDDEL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggataggtattttggaagatttggtgggatgtatgcaccagaaactcttatgccagct
cttttagagatagaagaagagttttgcaagcttgtgaaagatgaaaattttctctctgaa
tatgagtactatctcaaaaactatgttggaagaccatcgccactttactttgccaaaaac
ttgagcaatcatcttggggttaaaatatatctcaaaagagaagacctaaaccacaccggt
gcacacaagataaacaactgcattggccaggcacttttggcaaagcatatgggcaaaaaa
agacttattgccgagacaggagcaggtcaacacggtgttgcaacatctacagttgctgct
ctttttgggatggaatgcgagatatttatgggtgaagaagatgcaaaaaggcagtttcat
aacgtgcagaggatgaaaatgcttggcagcaaggtaagagtagttaacaagggaagcaag
accttgaaagacgcaataaacgaggcaatgcgtgactggagcgagacgtttgagtatacc
ttttatctttttggtacagctgcaggacctcatccgttcccaacaattgtaaaatacttt
caaagtgtgattgggaaagagacaaaagatcagataaaaaggcttgaaggaagacttcca
gactatatctttgcgtgtgttggtggtggttctaacgcaattggtatcttctcagcgttt
ttggaagatcatgaagtaaagcttattggcgttgagggtgcaggagagggaatacataca
ggcaaaacggctgcgacgctatgcagcgggtctgttggaatcttgcacggtgctaaaacg
tatattttacaggatgaggaagggcaaattcaaaacacacattcaatctcagcagggctt
gactacccgggtgttggacctgaacatgcatatttgaaagagacaggaagggttgagtat
gtaggggctactgacaaagaagctgtggatgcatttttgctgctcacaaggcttgaaggg
ataattccagcgctggagtcgagccatgcccttgcagaggttattaaaagggcaaagatg
ggactgttcaaaaccagtgacattgtggttgtgaacctttctggaagaggtgataaggat
ataaatacagtacttgagctttggaaggatgatgagctatga

DBGET integrated database retrieval system