KEGG   Caldicellulosiruptor hydrothermalis: Calhy_1061Help
Entry
Calhy_1061        CDS       T01346                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
chd  Caldicellulosiruptor hydrothermalis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:chd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Calhy_1061
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Calhy_1061
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Calhy_1061
Enzymes [BR:chd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Calhy_1061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1080711..1081481
Genome map
AA seq 256 aa AA seqDB search
MNLIDERFEKLKKEGKKAFIGYVTFGYPSFEETLGFIKLVYSYVDILEIGFPFSDPIADG
EIIQKASRKALSEGVKLSHLFESIEKFKKDKPVVLMLYANTVYKRGIDRFFESSKACGVD
GVIIPDVSFEESFEFKEVAEKFGIVYIDLVSISSLERAKMIGRQSRGFLYCVSRKGVTGF
KGQIDDRIFTFLKELKTVTSTPLAVGFGIKSKEDVQKFKDLADGIVIGSAIITKIDEGKD
KLEDFLKEISESLKDK
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaatagatgaaagatttgaaaagctaaaaaaagagggcaaaaaagccttcata
ggctatgttacgtttggatatccctcttttgaagagacacttgggtttataaagcttgta
tattcatatgtagacattttagagattggttttcctttttctgaccctattgcagacggt
gaaattattcaaaaagcatcaaggaaggctctcagtgaaggtgttaaattgagccacctt
tttgaaagcattgaaaagtttaaaaaagataagccggttgtgctaatgctgtatgcaaac
acagtttacaaaaggggaattgataggttttttgaaagtagcaaagcttgcggtgtggat
ggcgtgataatcccagatgtttcgtttgaagagagctttgagttcaaagaagtagctgaa
aagtttggtattgtctatattgaccttgtatcaatatcttctcttgagagagccaagatg
ataggtaggcagagccgtggttttttgtattgtgtttcaagaaaaggtgtgacaggtttc
aaagggcagattgatgataggatttttacttttctaaaagaactaaaaaccgttacctca
acacctttggcagttggatttggtataaagagtaaagaagatgtgcaaaagttcaaagac
cttgctgatggtattgttattggaagcgctataatcacaaagatagatgaaggaaaagac
aaacttgaggattttttgaaagaaatctcagaaagtctaaaagacaaataa

DBGET integrated database retrieval system