KEGG   Caldicellulosiruptor hydrothermalis: Calhy_1093Help
Entry
Calhy_1093        CDS       T01346                                 

Definition
dtdp-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
chd  Caldicellulosiruptor hydrothermalis
Pathway
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:chd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Calhy_1093
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Calhy_1093
Enzymes [BR:chd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Calhy_1093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1108941..1109549
Genome map
AA seq 202 aa AA seqDB search
MFKEVNKSIIPGCFEFIPDIKEDQRGMFVKIYNTDFYSSILLNTSIKESYFTISHKNVIR
GLHFQLPPYEVAKIVCCVEGEIMDVVVDLREGSPTYGKYDIFYLSAEKSNILYIPEGLAH
GYCVLSEKAIVIYNVTNVYSKEHDTGIRWDSVGIPWPVDNPILSEKDKNLPEFKYFHTPF
KYKGYVNINVENLMDKIIGNKI
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaagaagtaaataagtcgataattcctggttgttttgaatttatccctgatata
aaagaagaccaacgtggtatgtttgtaaaaatttataatactgatttttatagtagcata
ttgcttaacacaagtataaaagaaagctactttactatttctcacaaaaatgtaataagg
ggtttacattttcaattaccaccttatgaagtagctaaaattgtgtgttgtgttgaggga
gagataatggatgttgttgtagacttaagagagggttctccaacctatggtaagtatgat
attttttatctaagcgcagaaaaatctaatattttatatattcccgagggattagcacat
ggttactgtgttttgagtgaaaaggcaatagtaatttataatgttacaaatgtatattca
aaagaacatgatactggaataagatgggatagtgtaggaattccttggccagttgataat
cctatactttcagaaaaggacaaaaatttaccagagtttaaatatttccatactcctttt
aagtataagggttatgtaaatataaatgttgagaatttaatggataaaattattgggaat
aaaatttag

DBGET integrated database retrieval system