KEGG   Caldicellulosiruptor hydrothermalis: Calhy_1199Help
Entry
Calhy_1199        CDS       T01346                                 

Definition
4-diphosphocytidyl-2C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
chd  Caldicellulosiruptor hydrothermalis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:chd00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1228728..1229588
Genome map
AA seq 286 aa AA seqDB search
MELKAYAKINLALDVLSKREDGYHEIRTIMQTVDLYDIINIEKIEEDSIIVTTSSENIPT
DNKNHAYIAASLLKERFDVKQGVRIHIEKNIPVSAGLAGGSTDAAAVLKGLNEIFELNLS
EQQLMEIGREIGADVPFCLVGGTALCEGIGEKVIKLKSAPQMNILIAKPEVYVSTQAVYE
ALDLSKIKKRPNIEAMISAIEEGNVKEIAKNLCNVLEVVTVNQYPVINRVKDIMRNNNAL
GTVMTGSGPAVFGIFGNKYDALKAAERLKVFIKEIILTTTCEGSGF
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
ttggaactcaaggcttatgctaaaatcaacttagcattagatgtgctttcgaaaagagaa
gatggctatcatgaaataagaactataatgcaaacagtggatttgtatgatataatcaat
attgaaaagatagaagaagacagtataattgtaacaacttcaagtgaaaatattccaact
gacaataaaaaccatgcatacattgcggcttcacttttaaaagagcgttttgacgtaaag
caaggtgtgagaatacatattgaaaagaacattccggtctctgcgggtttagctggtgga
agcactgacgcagcagcagttttaaaaggtctgaatgaaatatttgagctaaatctttct
gagcagcagcttatggaaatcggaagagagattggtgctgatgttccattttgtttggta
ggtggcacagccctctgtgagggaattggcgaaaaggttataaaactaaaatcagctcct
cagatgaatatcctcattgcaaagccagaggtatatgtttctacgcaggctgtgtatgag
gcgcttgatcttagcaagataaaaaagagaccaaacattgaagctatgatttcggcaatt
gaagaaggcaatgtaaaagagatagcaaagaatctttgcaatgttttagaggtggttaca
gtaaatcagtatccagtcataaacagagtcaaggacattatgagaaataacaatgctctt
gggacagttatgacaggaagcggaccagctgtatttgggatttttggcaacaagtatgat
gctttaaaagctgcagagaggcttaaagtattcataaaagaaattatcttgactacaaca
tgtgaaggtagcggattttag

DBGET integrated database retrieval system