KEGG   Caldicellulosiruptor hydrothermalis: Calhy_1330Help
Entry
Calhy_1330        CDS       T01346                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
chd  Caldicellulosiruptor hydrothermalis
Pathway
chd00010  Glycolysis / Gluconeogenesis
chd00051  Fructose and mannose metabolism
chd01100  Metabolic pathways
chd01110  Biosynthesis of secondary metabolites
chd01120  Microbial metabolism in diverse environments
chd01130  Biosynthesis of antibiotics
chd01200  Carbon metabolism
chd01230  Biosynthesis of amino acids
Module
chd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
chd_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:chd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calhy_1330
   00051 Fructose and mannose metabolism
    Calhy_1330
   00562 Inositol phosphate metabolism
    Calhy_1330
Enzymes [BR:chd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     Calhy_1330
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Calhy_1330
Exosome [BR:chd04147]
 Exosomal proteins
  Proteins found in most exosomes
   Calhy_1330
  Exosomal proteins of colorectal cancer cells
   Calhy_1330
  Exosomal proteins of bladder cancer cells
   Calhy_1330
  Exosomal proteins of melanoma cells
   Calhy_1330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGK TIM SIS_2
Motif
Other DBs
NCBI-ProteinID: ADQ07049
UniProt: E4QA77
Position
1363726..1365678
Genome map
AA seq 650 aa AA seqDB search
MPKLNKKTIRDIDVSGKRVLVRVDFNVPQDENGNITDDRRIREALPTIKYLIDHNAKVIL
VSHLGRPKGKFDPKYSMAPVAKRLSELLGKEVVLAKDVIGDDAKKCVEQMKERDVVLLEN
VRFHKEEEENDREFAKALASLADIYVNDAFGTAHRAHASTAGVAEFLPAVAGFLMEKEIE
MLGNALANPQRPFVAILGGAKVSDKIGVITNLLEKVDSLLIGGAMAYTFLKAKGYKIGKS
KCEDDKLDVAREIMKKAEEKGVNLLLPVGSIVAKEFKNDTEFMYVPSDAMPDDMMGMDIG
NTTIELFSKEIKKAKTIVWNGPMGVFEFPNFAKGTEAIARAVAEAVEENGAIAIIGGGDS
AAAVEKLGFADKMTHISTGGGASLEFLEGKVLPGIACLLDKNPRKKIIAANWKMNKTPIE
AKEFVEELKKYIDDVQAEVVICAPSILVPYVKEAIEGTNIKLGTQNMFYEEKGAYTGEIS
GPMLKEVGVEYVVIGHSERRQYFGETDEIVNKKVLAALKFGIKPIVCVGETLKQREYGIT
DELVRLQVKIALNGVSKEDVEKVVIAYEPIWAIGTGKNATPEEANRVIGVIRNVIAEIYD
EDTAQKVRIQYGGSVNSANSADIFNMPEIDGGLVGGASLNAQEFAKILHY
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagctcaacaaaaagaccataagagatatagatgtaagcggtaaaagggttctt
gtgagggttgactttaatgttcctcaagatgaaaatggcaatatcactgatgatagaaga
ataagagaagctcttcctacaataaagtatctcattgaccacaacgcaaaggtaatattg
gtatcccatttgggaagaccgaagggcaaatttgacccgaaatactcgatggctcctgtt
gcaaaaagactttctgagcttctcggcaaggaagttgttcttgcaaaagacgttataggc
gatgatgcaaaaaagtgtgttgagcagatgaaagaaagagatgtagttcttcttgaaaat
gtcagattccacaaagaggaagaagaaaatgatagagaatttgcaaaggctttagcctcg
cttgcagacatttatgtcaatgacgcatttggtacagctcacagagcacatgcatcaaca
gcaggtgttgcagagttcttgcctgcagttgctggatttttgatggaaaaagagatagaa
atgcttggcaatgctcttgcaaatccgcaaagaccttttgttgcaatcttgggtggcgca
aaagtttctgataagattggggttattacaaatcttcttgaaaaggttgatagtctctta
attggcggtgcaatggcttataccttcttgaaggcaaaaggatataaaatcgggaagtca
aaatgcgaagatgataagcttgatgttgcaagagagataatgaaaaaggcagaggaaaaa
ggagtaaaccttctgctgcctgttggaagcatagtagcaaaagagtttaaaaatgataca
gagtttatgtacgtaccatcagatgcaatgccagacgatatgatgggtatggacataggg
aataccacaattgagcttttctcaaaagagataaagaaggcaaagaccattgtttggaac
ggaccaatgggtgtatttgaatttccaaactttgcaaagggaacagaagctatcgcaaga
gctgttgctgaggctgttgaagaaaatggcgcaattgcaattatcggtggtggcgactct
gcggctgctgttgaaaaactggggtttgctgataagatgacacatatttcaacaggtggc
ggtgcttcattagagttcttggaaggcaaagttttaccaggtattgcatgtcttcttgat
aaaaatccaagaaaaaagataatcgcagcaaactggaagatgaacaagactcctattgag
gcgaaagagtttgttgaagagctgaaaaaatatattgatgatgttcaggcagaagtagtt
atctgtgctccatcaattcttgttccttatgtcaaagaagcaatagaaggaacaaatata
aaacttggaacacaaaacatgttctatgaagaaaaaggtgcatatacaggtgagatctca
ggtccaatgttaaaggaagttggagttgagtatgtggtaattggtcactctgaaagaagg
cagtactttggtgaaactgatgagattgtgaacaagaaagtgttagcagcgctcaagttc
ggtatcaagcctattgtatgtgttggtgagacacttaagcaaagagaatatggtattaca
gatgagcttgtaaggcttcaggtcaagattgcactaaatggtgtctcaaaagaagatgtt
gaaaaggttgtcattgcatatgagcctatctgggcaataggtacaggtaagaatgcaaca
cctgaagaggcaaatagagtaattggggttatcagaaatgtaattgcagagatttacgat
gaagatactgcgcaaaaggttagaattcagtatggcggaagtgtaaactctgcaaattca
gcagacattttcaatatgccagagattgatggaggcttagttggcggtgcaagccttaat
gctcaggaatttgcaaagatattacactactaa

DBGET integrated database retrieval system