KEGG   Caldicellulosiruptor hydrothermalis: Calhy_1411Help
Entry
Calhy_1411        CDS       T01346                                 

Definition
(GenBank) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
chd  Caldicellulosiruptor hydrothermalis
Pathway
chd00330  Arginine and proline metabolism
chd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chd00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Calhy_1411
Enzymes [BR:chd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Calhy_1411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase UPF0489
Motif
Other DBs
NCBI-ProteinID: ADQ07128
UniProt: E4QAV0
Position
complement(1443830..1444684)
Genome map
AA seq 284 aa AA seqDB search
MGFNLYKPFFLCATENYQASTIVLAGIPMDFTVSFKPGSRFAPAKIREVSIELEEYSIYQ
DKTLYDKTFCDMGDLELPFGNVEKSIETIYQFACKLFEEKKVPIFLGGEHLISFPLIKAA
ANSNGKEFYVLHFDAHADMREEYLGEKFSHATVMRRVGEVIGFKNIYQFGIRSGSKEEIE
FAKKNSNLYFVDKCEINNVIKDLKGKKVYLSIDIDVFDPAFAPGTGTPEPGGILSSDFFD
ILLKLKDLNIIGADIVEVAPYYDISDRTALLAAKIVRELILMIE
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgggctttaatctctacaaacctttttttctatgtgcaacagaaaattatcaagcaagt
accatagttttagcaggaattcctatggatttcacagtgagctttaaaccaggctcacgt
tttgctcctgcaaagataagagaagtctcaatagagctggaggagtattctatctatcaa
gacaaaaccctttatgataagacattttgtgatatgggagatttagagcttccttttgga
aatgttgaaaaaagtattgagacaatatatcaatttgcttgtaagctgtttgaagagaaa
aaagttcctattttcttgggcggtgaacatctaatcagttttcctctaataaaagcggcg
gcaaattcaaacggtaaagagttttatgtacttcactttgatgctcatgctgatatgaga
gaggagtatcttggtgaaaagttttcacatgccactgttatgagaagagtgggtgaggta
ataggttttaagaatatataccagtttggtataaggtcggggtctaaagaagaaattgaa
tttgcaaaaaagaatagcaatctttattttgttgacaagtgtgaaattaataatgttatt
aaagatttaaaaggcaagaaggtatatctgtcgatagatatagatgtttttgacccggct
tttgcccctggtacaggaacacctgagccaggtggaattctatcttcagatttttttgac
attttacttaaattaaaagacctcaatataataggagcagacatagtggaagttgcccca
tattatgatatttctgacagaacagcactacttgctgcaaagatagtaagagagctgata
ttgatgattgaataa

DBGET integrated database retrieval system