KEGG   Caldicellulosiruptor hydrothermalis: Calhy_1583Help
Entry
Calhy_1583        CDS       T01346                                 

Definition
utp-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
chd  Caldicellulosiruptor hydrothermalis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:chd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Calhy_1583
   00052 Galactose metabolism
    Calhy_1583
   00500 Starch and sucrose metabolism
    Calhy_1583
   00520 Amino sugar and nucleotide sugar metabolism
    Calhy_1583
Enzymes [BR:chd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Calhy_1583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1610790..1611698)
Genome map
AA seq 302 aa AA seqDB search
MRRLIKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEALESGIESILIVTGR
GKRAIEDHFDKSFELEVALENKKDYDNLQLIRKIADYNVHYIRQKEPRGLGDAVYCARLF
IDNEPFAVLLGDDIIISEKPCLKQLIEVYEEYRTTILGVQKVPEDDVSKYGIIAGKQIED
RIYKVKDLVEKPKKEEAPSNIAVLGRYIITPEILNILQHTKEGVGGEIQLTDALRELSKK
EAMYAYEFEGKRYDVGNKLGFLQATVEIALSREDIGKDFYNYLVTLVNAKNYKEKLNELE
KI
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgagaagacttatcaaaaaagcaatcattcctgcggcaggacttggaacaaggtttttg
ccggcaacaaaagcacagccaaaagagatgcttcccattgtggacaagccaacaattcaa
tacatagtagaagaggcgttagaatcagggatagagagcattttaattgtcacagggcgt
ggcaaaagagcaattgaagaccattttgacaagtcttttgagcttgaggttgcactcgaa
aataaaaaggattatgacaatcttcaattgataagaaaaatagcagattacaatgtccat
tacatacgccaaaaagaaccaagaggacttggtgatgcagtatactgtgcaagacttttt
atcgacaacgaaccttttgcagttttgcttggtgatgatatcatcatttctgaaaagcca
tgtttgaaacagctgatagaggtgtatgaagagtacaggacaaccatcttgggtgtgcaa
aaagtaccagaggatgatgttagcaagtatggaattattgcagggaaacagatagaagat
agaatctataaggtaaaagaccttgttgaaaaaccaaaaaaggaagaagcaccttcgaat
attgctgtgcttggaagatatatcatcactcctgagatattaaatattctacaacataca
aaagaaggcgttggtggcgagattcaattgactgatgctttaagagagttatcaaaaaaa
gaagctatgtatgcttatgagtttgaaggaaaaaggtatgatgtgggcaacaaacttggt
tttttgcaggcaacagtcgagattgctctttcaagagaagacattggcaaagatttttac
aattatcttgttactcttgtaaatgccaagaattataaagagaaattaaacgagttagaa
aaaatttaa

DBGET integrated database retrieval system