KEGG   Caldicellulosiruptor hydrothermalis: Calhy_1619Help
Entry
Calhy_1619        CDS       T01346                                 

Definition
holliday junction DNA helicase ruva
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
chd  Caldicellulosiruptor hydrothermalis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:chd03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1645231..1645824)
Genome map
AA seq 197 aa AA seqDB search
MIDSIVGTIQEVFNNYVILNYNNIYIKIFCNGTKFSEFLGKEKRVYVSLKFNENLSEIEC
YGFLTREERELFLKLQKVTGVGSKLALQILSSIDFQELIVEIAKGNVARLEKVKGIGKKT
ASRIILELKETLKKEFKVGSTSGKEEKTYEKLEEISLALLSLGYDIDEVNQVLSSEDFSE
LSLEDGIKLALKKLSKI
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgatagattctattgtgggaaccatccaagaggtatttaataattatgttatcctcaat
tacaataacatatacataaaaatattttgcaatggtacaaaattttctgaatttttaggc
aaagaaaagagagtgtatgttagcctaaagtttaacgaaaatttatcagagattgaatgt
tatggctttttgacaagggaagaaagggaactttttttaaagcttcagaaggtaaccggt
gttggcagcaaattagctcttcagattctttcctcaatagactttcaagagcttattgtt
gagattgcaaagggaaatgtggcaagacttgagaaggtaaaaggaattgggaaaaaaact
gcgagcaggataattcttgagctcaaagagacactcaaaaaagagttcaaagtgggttct
acttcaggtaaagaagaaaaaacttacgaaaaacttgaagaaatatctttggcactttta
tccttggggtatgacattgatgaagtgaaccaggttctttcatccgaagatttttctgaa
ctttctttggaagatggaataaaacttgctttgaaaaagttatcaaagatttga

DBGET integrated database retrieval system