KEGG   Caldicellulosiruptor hydrothermalis: Calhy_1622Help
Entry
Calhy_1622        CDS       T01346                                 

Definition
glycoside hydrolase family 4
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
chd  Caldicellulosiruptor hydrothermalis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:chd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Calhy_1622
  Lipid metabolism
   00561 Glycerolipid metabolism
    Calhy_1622
   00600 Sphingolipid metabolism
    Calhy_1622
Enzymes [BR:chd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Calhy_1622
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1647054..1648370)
Genome map
AA seq 438 aa AA seqDB search
MLKIAIIGAGSGVFTRNLVRDILSYPELRNSTIALMDIDSIRLEFMRKALQKLIDQEKYS
TRLEATTDRKEALKGAKYVVVTIQVGGLKPYEYDIYIPLKYGVKQAVGDTIGPGGVFRAL
RTIPVLLDIAKDMEELCPDALLLNYVNPMAMNCWALNKATNKKNVGLCHSVQGTAEFLAK
IIGAKMEEVSYLCAGINHMAWFLKFEWNGKDAYPLIREKANDPEIYTQDVTKFEILKHFG
YYVTESSFHMSEYVPYFRKSDDWINRIHKTHSWHKEHYNGMYLHCCLDAAKTLLDDLKKM
AEADYIDPKRSNEYCATIIHSIETNTPAVINGNVENKGLITNLPEGCCVEVPCLVDKNGI
QPTYVGDLPPQLAALNRTNINVQELTVLAALMGDREAVYHAIMMDPLTSAVLDLDQIRQM
VDEMFEAEKEWLPEKFYR
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaaatagctatcataggtgcaggaagtggagttttcacaagaaacttggtaaga
gacattttgtcatatccagagctaagaaactctacaatagcgcttatggacattgacagt
ataaggcttgaatttatgagaaaagctctgcaaaaactcattgaccaggagaagtattct
acccggcttgaagccacaaccgatagaaaagaggctttaaaaggtgcaaaatatgtggtt
gtcacaatacaagttggaggtttaaaaccttacgaatatgacatttacattcctctaaaa
tacggtgtaaaacaggcagttggcgatacaataggtccaggtggagttttcagggctctg
cgaacaataccggttttacttgacattgcaaaggacatggaagagctgtgtcctgacgca
cttttgctcaattatgtaaatccaatggcaatgaactgctgggcgttaaataaagctacg
aacaaaaaaaatgtagggctttgtcacagtgttcaaggaactgctgaatttttagcaaag
attattggggcaaaaatggaagaggtttcatacttatgtgcaggtataaaccacatggca
tggtttttaaaatttgagtggaatgggaaagatgcatatcctcttataagagaaaaggca
aacgacccggaaatttacacacaagatgtgactaaatttgagatactaaaacattttgga
tattatgtaacagagtcaagttttcacatgtctgaatatgttccctattttagaaagagc
gacgattggataaatagaatacataaaacacattcatggcacaaagaacattacaatggt
atgtatctacactgttgcttagatgctgcgaagactttacttgatgacctgaagaaaatg
gcagaggcagactacatcgacccaaaaagaagtaacgaatactgtgcaactatcatccat
tccatagagacaaatactccagctgtgataaatggtaatgttgaaaacaaaggtttaata
acaaatctacctgaaggatgctgcgttgaagtaccatgtttggttgacaaaaatggtatt
cagccaacttatgttggagatcttcctccacagcttgcagctttgaacagaacaaatata
aatgttcaagagctaactgttcttgctgctttgatgggtgatagggaagcagtttatcat
gcaattatgatggaccctctcacaagcgctgttttggatttagaccaaatacgccagatg
gttgatgagatgtttgaagcagaaaaagaatggctgccagaaaagttttataggtaa

DBGET integrated database retrieval system