KEGG   Caldicellulosiruptor hydrothermalis: Calhy_1815Help
Entry
Calhy_1815        CDS       T01346                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
chd  Caldicellulosiruptor hydrothermalis
Pathway
chd00010  Glycolysis / Gluconeogenesis
chd00020  Citrate cycle (TCA cycle)
chd00620  Pyruvate metabolism
chd00633  Nitrotoluene degradation
chd00640  Propanoate metabolism
chd00650  Butanoate metabolism
chd00680  Methane metabolism
chd01100  Metabolic pathways
chd01120  Microbial metabolism in diverse environments
chd01130  Biosynthesis of antibiotics
chd01200  Carbon metabolism
Module
chd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:chd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calhy_1815
   00020 Citrate cycle (TCA cycle)
    Calhy_1815
   00620 Pyruvate metabolism
    Calhy_1815
   00640 Propanoate metabolism
    Calhy_1815
   00650 Butanoate metabolism
    Calhy_1815
  Energy metabolism
   00680 Methane metabolism
    Calhy_1815
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Calhy_1815
Enzymes [BR:chd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Calhy_1815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_2 Fer4_7 Fer4_10 Fer4_16 Fer4_9 Fer4_4 Fer4_13 Fer4_15 Fer4_3 Fer4_17
Motif
Other DBs
NCBI-ProteinID: ADQ07526
UniProt: E4QD32
Position
complement(1839154..1839453)
Genome map
AA seq 99 aa AA seqDB search
MRKMKITEDVTWKEITPAGVIIDPGNAEDFKTGDWRTMRPVWHEDKCKQCLFCFYVCPDS
SIKVENGKMVGVDYDHCKGCGVCTEVCPFKAFDFVEEKK
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagatgaaaataacagaagatgttacatggaaggaaataacaccggcaggtgta
attatcgacccaggtaatgcagaggactttaaaacaggcgactggagaacaatgagacct
gtatggcatgaagataagtgcaagcagtgtctgttctgcttctatgtatgtccagattca
tctataaaggttgaaaatgggaagatggtcggagttgactatgaccactgcaaaggttgc
ggagtttgcacagaggtttgtccatttaaagcttttgattttgtagaggagaagaaataa

DBGET integrated database retrieval system