KEGG   Caldicellulosiruptor hydrothermalis: Calhy_1909Help
Entry
Calhy_1909        CDS       T01346                                 

Definition
(RefSeq) udp-n-acetylglucosamine 1-carboxyvinyltransferase
Organism
chd  Caldicellulosiruptor hydrothermalis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1943429..1944697)
Genome map
AA seq 422 aa AA seqDB search
MQKLIIYGPAKLLGEIEIEGAKNAALPILTASILAQNKVIITNVPDIADVRHTIEILEYL
GCKVLFENNTVVVDSSSIKRFTIPAEYAKLMRSSVLFMGALLSKFRRAELSNHPGGCEIG
QRPIDLHISAFRQLGIEVFEHNNRIMCRCDKVKGSEIFLPIPSVGATENIILASIFCDGE
VVIKNAAKEPEITDLCHFLNKLGAKIRGAGTHIIKIEGVKRLKSEEVVHKVIPDRIVAGT
YLCAVAACGGEVVLKNVFPRHLDSILHILKNSGCKIKESKNEIWIKREERLKGGQRITTH
YYPGFPTDLQAPVCSAFAVANGVTIIKETIFENRFKHVPELVKMGADIHVEKDIAVINGV
EKLRGCKVFARDLRGGAALFVAGLSAHGVTEVMDADYIDRGYEKIEEKYSLLGAKILREK
GE
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaacttatcatatatggtccagcaaagctcctgggagagattgagattgaaggt
gcaaaaaatgcagcacttcccatactgacagcttctattttagcccaaaacaaagttatt
atcacaaatgtacctgatattgctgatgtgagacatacaatagagattcttgaatatctt
gggtgcaaggttttgtttgaaaacaatacagtggtggtagatagtagctcaattaaaaga
tttaccattccagctgagtatgcaaagcttatgcggtcaagtgtactttttatgggagca
cttttgagcaagttcagaagagcagaactatctaatcatccaggggggtgtgagataggg
caaagaccaattgaccttcacatctcagcttttagacagcttgggatagaggtatttgaa
cataataacagaataatgtgccgctgtgacaaagttaaaggcagtgaaatttttttgcca
attccctcagttggagcaacagaaaatataattcttgcttccatattttgtgatggcgag
gtagtgataaaaaatgcggcaaaagagccagagataactgacctttgtcattttttaaat
aagcttggtgcaaagattagaggtgcaggtacacacataattaagattgagggtgtgaaa
aggttaaagagtgaagaggtagttcacaaggttattcctgatagaattgtagcagggacg
tacctgtgtgcagttgctgcatgtggcggtgaagtggttttaaaaaatgtatttccaaga
cacttagattcaattttgcacatactcaagaatagcggatgcaaaattaaagagtcaaag
aatgaaatttggataaaaagagaggaaagattaaaaggcggtcaacggataaccacacat
tattatcctggttttcccacagaccttcaggctcctgtttgcagtgcgtttgcagttgca
aacggagttacaataatcaaggagaccatctttgaaaacaggttcaaacacgtacccgaa
cttgtcaaaatgggtgctgatatacatgttgaaaaggatattgcagtgataaacggtgtt
gagaagttaagaggttgtaaggtttttgcacgtgatttgagaggtggtgcagcacttttt
gtagcggggctttctgctcatggagtaacagaggttatggatgcagactacatcgacagg
ggatacgagaagatagaggaaaaatactctttgcttggtgcaaagattctgagagaaaaa
ggtgagtga

DBGET integrated database retrieval system