KEGG   Caldicellulosiruptor hydrothermalis: Calhy_2001Help
Entry
Calhy_2001        CDS       T01346                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
chd  Caldicellulosiruptor hydrothermalis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:chd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Calhy_2001
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Calhy_2001
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Calhy_2001
Enzymes [BR:chd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Calhy_2001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2049165..2050646)
Genome map
AA seq 493 aa AA seqDB search
MRYISTRGNKEVQAKEAIYRGIAEDGGLYTPVSIPSLDLSKIKNIDSYANLAKYIFELYL
TDFTNEEIADCIDKSYSRGKFDTKDVVAIKKLSPGLFALELWHGPTYAFKDVALQVLPHL
LLKSMPTFYKQALILVATSGDTGKAALEGFKDVDRTKIVVFYPSEGVSDVQKRQMTTQEG
RNTFVAGIKGNFDDAQSGVKEIFTSKKCIDTIENLGFFFTSANSINFGRLLPQIVYYIWS
YLVLLKAGDISEGEKINFVVPTGNFGNILAGFIAKLMGIPINKLIVASNINSVVADFVRT
GLYDRRREFYKTISPSMDILVASNLERLLYLVTKDSERVKKYMLDLKSDGYFKVEEEVLK
EIQESFWGDFSTDDQTRNSIKSIYREYGYLVDPHSAVGFDVYRKYQKQTFDSTKTVVLQT
ANPYKFAKDVLNALFDGEYNNIDPFEAVEILYAKTGVEVPEGIKSLLSKPILHPNVIEKD
KMFDFILEKIRDN
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcgatatataagtacaagaggaaataaagaggtgcaggcaaaagaggctatttacagg
ggaatagctgaggatggtgggctttacacccctgtttcaattccttctcttgatttaagt
aagataaaaaacatagactcttacgcaaatcttgcaaaatatatatttgagctctacctt
actgattttacgaatgaagaaattgctgattgcattgacaagtcatatagccgtggcaag
tttgacacaaaagatgttgtggctatcaaaaagctcagcccgggtctttttgctcttgag
ctttggcacggtccgacgtacgctttcaaagacgttgcattgcaggtgcttcctcatctt
ttgctaaaatcaatgcccactttttacaaacaggcactcatacttgttgcaacatcaggc
gatactggcaaagctgccttggaagggtttaaggatgttgatagaacaaagatagttgtg
ttttatccatctgagggtgtgtcagatgttcagaaaagacagatgacaacccaggaaggc
agaaacacttttgttgccgggataaaaggcaattttgacgatgcccaatctggcgtgaag
gagattttcacaagcaaaaaatgcatagatacaatcgaaaatctggggtttttctttacc
tctgcaaactcaataaattttggtaggcttcttccacagattgtatactatatctggagt
tatctggtgcttttaaaggctggagatatatctgaaggtgaaaagataaactttgttgtt
ccgacaggcaattttggcaatatattggcaggttttattgcaaaacttatgggaattcct
ataaataagctgattgttgcttcgaacataaacagtgtggttgccgattttgtcaggaca
ggcttatatgacagaagaagagagttttacaaaacaatctcaccttcaatggatattctt
gttgcaagtaatttggaaaggttattgtatttggtaacaaaagattcagaaagagtaaaa
aaatacatgttagatttgaaaagtgatgggtatttcaaagttgaagaagaagttttaaaa
gagattcaggaaagtttctggggtgatttttccacagatgaccagacaagaaatagtata
aagagtatttaccgcgagtatggctatcttgttgacccgcactctgctgttgggtttgat
gtttacagaaagtaccagaagcagacgtttgatagtacaaaaacggttgtacttcaaact
gcaaatccttacaagtttgcaaaagatgttttgaacgctttgtttgatggtgaatataat
aatattgacccgtttgaagcggtagagattttgtatgcaaagacaggtgttgaggtcccg
gaggggattaaaagtcttctttcaaagccaattttgcatcctaacgtgatagaaaaagac
aagatgtttgattttatattagagaaaataagagataattaa

DBGET integrated database retrieval system