KEGG   Caldicellulosiruptor hydrothermalis: Calhy_2038Help
Entry
Calhy_2038        CDS       T01346                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
chd  Caldicellulosiruptor hydrothermalis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2084606..2086675)
Genome map
AA seq 689 aa AA seqDB search
MKGCVYGKLKRFSTLILAILFLVATLIGIESAKVSKVSGATKKSFVEFNFENKFATPFKA
SGKSMTLKIDSTTAAEGTFSLLASGRKQIDDGVLLDVTNLIDYANEYIITLYVYHKSSKL
QRFVVSSEIETKSGKENKLLCEKVIMPNSWKKLDASLNLTELKGIKKVWLKVYVPTSTTN
FYVDLFTLKVADSSHLIKFESFEDKNIAGFISQDKKCKLSVSKEKAYQGTYSIKFQQIAK
KQNTTVTLPVKGTFEKGKSYSISFYVYQPILKSLNLAVGVRFLENGKNTKEIVLGKVTVP
KNKWTEVFASYTPSLDSKIKDFVIFIRPLSDISYYYFDNFTISDDGWYSAVPDLDLPSLS
EKYKNYFKVGVAVPYKALTNPVDVAFIKRHFNSITAENEMKPEALEPYEGTFNFSIADEY
LDFCKKNNIAIRGHTLVWHQQTPSWFFQNPQTGEKLTNSEKDKKILLERLKKYIQTVVSR
YKGRIYAWDVVNEAIDENQPDGFRRSNWFNILGPEYIEKAFIYAHQADPNAQLFYNDYST
ENPVKREYIYKLIKDLKEKGVPIHGVGLQCHISVSWPSVEEVEKTIKLFSSIPGIKIHVT
EIDISISKEFGEDIDEETKRYLLIQQARKLKDLFEVFKKYKNVVTSVSFWGLKDDYSWLK
GDFPLLFDKDYQPKFAFWSLIDPSVVPEE
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggttgtgtttatggaaaattgaaaaggttttcgacattgattttagcaatttta
tttttggttgcaaccttgattggcatagaaagtgctaaagttagtaaagttagcggagca
acaaaaaagagttttgtggaatttaattttgaaaataaatttgcaacgccgtttaaagca
tcgggcaaatctatgactttaaagattgacagtacaaccgcagcagaaggaaccttttca
cttcttgcaagtggccgaaagcaaatagatgatggagttttgcttgatgtaaccaatctt
atagattatgcaaatgaatatataattactctatatgtttatcacaagtccagcaagctg
cagcgttttgttgtgagtagcgaaattgagacaaaaagcggaaaggaaaataaactgctg
tgcgagaaggttatcatgccaaatagctggaaaaaacttgatgcaagtttaaatttgact
gagctaaaagggattaaaaaagtttggctaaaggtatatgtgccaacctcaaccacaaat
ttttacgttgacctttttacactcaaagttgccgacagctctcatctcataaaatttgaa
agctttgaagacaaaaacatagcaggatttatttctcaggataaaaaatgtaaattgtca
gtctcaaaagaaaaagcttatcaaggtacatatagcataaagtttcagcagattgcaaaa
aagcagaatacaactgttactttgccggtgaaaggtacatttgaaaagggtaagagctat
tcaatatctttttatgtgtatcagcccattttaaagagtttaaacttggcagttggcgtt
aggtttctggaaaatggaaagaacacgaaagagattgtgcttgggaaagtaactgttcca
aagaataagtggacagaagtatttgcaagttatacgccctctttggattcaaagataaaa
gactttgtgattttcataagacccctttcagatatttcctattattattttgacaacttc
acaatttcagatgatgggtggtattcagctgtgcctgatttagatttaccttctttaagt
gagaaatacaaaaactactttaaagttggtgttgctgtaccctacaaggctttgacaaat
cctgttgatgttgcattcataaagagacattttaacagcattacagcagaaaacgagatg
aagccagaagcacttgagccgtatgaaggaactttcaacttttcaattgctgatgagtat
ttggatttttgcaaaaagaataatatagctattcgtggacacactcttgtgtggcatcag
caaacgccaagctggtttttccagaaccctcagacaggggagaagctgacaaacagtgaa
aaagacaagaagatacttttggagaggttaaaaaaatatatccagacagttgtttcaaga
tacaagggccgaatttatgcttgggatgttgttaatgaggctattgacgaaaaccagccg
gacggttttagaagaagcaactggttcaatatattaggtccagagtatatcgaaaaagcg
ttcatatacgctcatcaggcagaccctaacgctcagcttttttacaatgactacagcaca
gaaaatccagtgaagagagaatacatttacaagcttataaaagacctaaaagaaaaagga
gtacccattcatggtgttggtcttcagtgccatatctctgtgagctggccaagcgttgaa
gaggtggaaaaaaccataaaactttttagcagcattcctggtattaagatacatgtcaca
gaaattgatataagtatctcaaaagaatttggtgaagatatagatgaagaaacaaaaaga
tatcttttgattcagcaggcaagaaagttaaaagatctttttgaagttttcaaaaaatac
aaaaatgtggtgacaagtgtttctttctgggggcttaaagatgactattcatggctgaaa
ggtgattttccacttttgtttgacaaagattatcagccaaaatttgctttctggagctta
atagacccgtcagttgtgccagaagaataa

DBGET integrated database retrieval system