KEGG   Caldicellulosiruptor hydrothermalis: Calhy_2064Help
Entry
Calhy_2064        CDS       T01346                                 

Definition
glycoside hydrolase family 5
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
chd  Caldicellulosiruptor hydrothermalis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:chd00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2122147..2124414)
Genome map
AA seq 755 aa AA seqDB search
MREIILKSGLLLIVVILIVSILRVLPVFAQSIPYEKEKYPNLLGNQAVKKPSVAGRLQII
EKDGKKYLADQKGEIIQLRGMSTHGLQWYGDIINKNAFEALSKDWECNVVRLAMYVGEGG
YASNPSIKEKVIEGIKLAIENDMYVIVDWHVLNPGDPNAEIYKGAKDFFKEIAMMFPNDY
HIIYELCNEPNPNEPGVENSLDGWKKVKAYAQLIIQMLRSLGNQNIIIVGSPNWSQRPDF
AIQDPINDKNVMYSVHFYSGTHKVDGYVFENMKKAFENGVPIFVSEWGTSLASGDGGPYL
DEADKWLEYLNANYISWVNWSLSNKNETSAAFVPYISGMHDATSLDPGDDKVWDIKELSI
SGEYVRARIKGIAYKPIERDSQIKEGQSAPLGEKVLPSTFEDDTRQGWDWDSPSGVKGPI
TIESVNGSKALSFEIEYPEKKPQDGWATAARLILKEINAKREDNKYLAFDFYLKPDRASK
GMIQIFLAFSPPSLGYWAQVQDSFNIDLAKLSSAKKIEDGIYKFNVFFDLDKIQDGKILG
KDTLLRDVIVVIADGNSDFKGKMFIDNVRCTNVLFEDINFESSLYDAVAKLYSKGIIKGI
SAFKYLPDKNITRAEFAALCVRALNLKIEKYDGRFSDVKNDAWYSDVVYTAFKNGLFEQE
KNRIFPERIMKREEAATLAIEVYRRLTGKIEVSTDDIQIADEGLINPQYRESVKLAIQLG
IIDLYSDGTFAPSKSVSRGEAATIFYNLLNLAGKL
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgagagaaattattttaaagtctggtctactcttgatagtggttattttgattgtttct
attttacgagttttacctgtatttgcccagagcataccgtatgaaaaggaaaaatatcca
aatcttcttggcaatcaggcagttaaaaaaccatcggttgccggcagactgcagattatt
gaaaaggacgggaaaaagtatttagctgaccagaaaggtgaaataatccagcttcgtggc
atgagtacacatggacttcaatggtatggtgatattataaacaaaaatgcatttgaggct
ctttcaaaagattgggagtgcaatgttgtaaggcttgcgatgtatgttggtgagggcggc
tatgcttcaaatccgagtatcaaagaaaaagttatagaagggattaagcttgctattgag
aatgacatgtatgtaattgttgattggcacgtgttaaatcccggtgacccgaatgctgaa
atttataaaggagcaaaagactttttcaaagagatagctatgatgtttcccaatgactat
cacataatatatgaactttgcaatgaaccaaatccaaatgaaccgggagtagaaaatagt
ttggatggttggaaaaaggtaaaggcttatgcacagctcattatacaaatgctcagaagt
ttggggaatcagaacattataattgtaggttcgcccaattggagccaaagacctgacttt
gcaattcaagatcctataaatgataaaaatgttatgtattcagttcatttttactctgga
actcacaaggttgatgggtatgtttttgaaaacatgaaaaaggcatttgaaaatggtgta
ccaattttcgtgagtgaatggggaacaagtttggcaagcggtgatggtggaccatatctt
gatgaggcggataagtggcttgagtatttaaatgcaaactatattagctgggtgaactgg
tcactgtcaaacaaaaatgaaacatcagctgcttttgttccgtatataagtggcatgcat
gatgccacatcacttgatcctggcgatgataaagtgtgggatataaaggagctgagtata
tctggagagtatgtgagagcaaggataaaaggaattgcatataagccaattgagagggat
agccaaataaaagaaggacaaagtgcacctttaggcgaaaaagtcttaccatccacgttt
gaagatgacacgcgtcagggctgggactgggatagtccgtctggtgtgaaaggccctatt
accatcgaaagtgtaaatggttcaaaagcgctatcttttgagattgagtatccagagaaa
aaaccacaagatggctgggcaacagctgcaagacttatacttaaagagataaatgccaaa
agggaagataacaaatatttagcttttgatttttatttaaagccagatagagcttcaaaa
ggtatgattcagatatttttagctttttcaccaccttccttaggttactgggctcaagta
caagacagttttaatatcgacttggcaaaactttcaagtgcaaaaaagatagaagacgga
atttacaaattcaatgtattttttgacttagataaaatacaggatggtaaaatcttgggc
aaagatacacttttgagagatgtaatagtagtcatcgcagatggcaatagcgattttaag
ggaaaaatgtttatagataatgttagatgtaccaatgtcctttttgaagatatcaatttt
gagagcagcctttatgatgctgtcgccaaactttattctaaaggaatcataaaaggaatt
tcagcatttaagtacttgccagataaaaacattacaagggctgaatttgctgcactttgt
gtcagggcattgaacctgaaaatcgaaaagtatgacggcaggttttctgatgtaaagaat
gatgcctggtattcggatgtggtttatacggcgtttaaaaatggtttgtttgaacaagag
aaaaatagaatctttcctgaaaggattatgaaaagagaagaagcagcaactttggcaatt
gaagtgtacagaagattgacaggtaaaatagaagttagcacagacgatattcaaattgcc
gatgaagggcttataaatcctcaatacagagaaagcgtgaagttagctattcagctcggt
attattgacctgtattcagacggaacatttgcaccaagtaagagcgtttcaagaggggag
gcggcaacaattttctataacctcttgaacttagcaggcaagctatga

DBGET integrated database retrieval system