KEGG   Caldicellulosiruptor hydrothermalis: Calhy_2094Help
Entry
Calhy_2094        CDS       T01346                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
chd  Caldicellulosiruptor hydrothermalis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:chd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Calhy_2094
Enzymes [BR:chd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Calhy_2094
Exosome [BR:chd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Calhy_2094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2154159..2156111
Genome map
AA seq 650 aa AA seqDB search
MIKKVKSTIYLSDIKKFESGEHFESYKFLGSRVVNYRGKVGTVFCVWAPNAKSVSVVGNF
NNWCGENHKMMRVYGSGLWWLFVEGIGEGELYKYEIIGADGKRVLKADPYAIYSELRPNT
ASIVRNIPDYEWHDQEWMEKRKTTPPYDKPINIYEVHLASWKMKKDGSLEKAGEFYNYRE
LAHMLVDYIKEMNYTHIELLPVLEHPLDMSWGYQPTGYFSLTSRYGSIEDFMYFVDIMHQ
NGIGVIVDWVPAHFCKDEHGLYRFDGTFLYEYEDELLRENYTWGTATFDFSKPQVQSFLV
SSAMFWFDVYHIDGIRVDAVSHIIYMNNNQKNRYGGHENIEGIEFIKKLNKAIFSKYPNV
LMIAEESTAFPLVTYPTYDGGLGFNYKWNMGWMNDTLKYLQKHPNERKHHHNLLTFSIMY
AFSENFILPFSHDEVVHGKKSLLDKMPGDYNQKFANIRLLYGYMYTHPGKKLLFMGGEFG
QFIEWRFYASLDWLLLDYPMHRMLQQYVKSLNRFYLENKALWELDNKMDGFRWIDVHNWQ
QSVISYLRFSKDPDDFLVVICNFGLASYENYKIGVPRKGMYLEVFNSDKAEFGGNNIVNT
EKLKTIDEVWHGYNQCIEFRLPALSCLIFKPIEFFNTQEEKNQNDNNIQT
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaagtgaaatctaccatttacctgtctgacataaaaaaatttgaatcagga
gagcacttcgaaagttacaagttcttggggagcagggttgtaaactatagaggcaaggtt
ggaacagttttctgtgtgtgggcaccaaatgctaaaagcgtgtctgttgttggaaatttt
aataattggtgcggcgaaaatcacaagatgatgagagtttatggcagtggactttggtgg
ctgtttgtagaaggcattggtgaaggagagctctacaaatatgagattattggtgctgat
gggaaaagggttttaaaagctgacccgtatgcaatctactctgagcttcgtcccaacaca
gcatcaatcgtaaggaatatcccggactatgagtggcatgaccaggaatggatggaaaaa
agaaaaacaactccaccatatgacaagccaatcaacatttatgaggtgcatcttgcatca
tggaaaatgaaaaaggatggaagtttagagaaggccggtgagttttataattaccgcgaa
cttgcccacatgctggtagactacataaaagaaatgaactatacacacatagaacttctg
ccagttttagaacaccctcttgacatgtcatggggttaccagccaacaggttacttttct
ctcacatcacgctacggtagtattgaggattttatgtattttgtagatattatgcaccaa
aatggaattggagtaatagttgactgggtaccagctcatttttgcaaagatgagcatgga
ctttataggtttgacggaacatttttatatgaatatgaggatgagcttttgagagaaaac
tacacatggggtactgccacatttgacttttcaaaaccacaggtgcaaagctttcttgtc
tcaagcgccatgttttggtttgatgtttatcacattgacggaataagggtagatgctgtt
tctcacatcatctacatgaacaacaaccagaaaaatagatatggcggacatgaaaacata
gaaggaattgaatttataaaaaagctcaacaaggcaatattctcaaaatatccaaatgtc
ctgatgattgccgaagagtcaactgcatttcctctggtcacatatccaacatacgacgga
gggcttggctttaattacaagtggaacatgggatggatgaacgacactttaaagtacttg
caaaaacatcccaacgagagaaaacatcatcacaatcttttgacattttccataatgtac
gcattttctgaaaactttattctgccgttttcacacgatgaggttgttcatggaaaaaaa
tctttgcttgacaagatgccaggtgattacaaccagaaatttgcaaacataagacttctt
tatggctatatgtacacacatccgggcaaaaagctccttttcatgggtggtgagtttggt
cagttcattgaatggagattttatgcatcgcttgactggctacttttggactaccccatg
caccgcatgcttcagcagtatgttaaaagcttaaatagattctatttagaaaacaaagct
ctatgggagcttgataacaaaatggatggttttagatggatagacgttcacaactggcaa
cagagtgtcatatcatacctgagattttcaaaagaccctgatgatttccttgttgtcatt
tgtaactttggtcttgcttcatatgaaaattacaaaataggcgtgccaagaaagggtatg
tatttggaagtatttaacagtgataaagctgaatttggtggtaataatatagtaaacaca
gaaaaacttaaaacaattgatgaagtatggcatggatataaccagtgcatagaatttagg
cttcctgcgctttcgtgtttgattttcaaaccaattgaatttttcaatactcaagaagaa
aagaatcaaaatgacaacaatattcagacatag

DBGET integrated database retrieval system