KEGG   Caldicellulosiruptor hydrothermalis: Calhy_2407Help
Entry
Calhy_2407        CDS       T01346                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
chd  Caldicellulosiruptor hydrothermalis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Calhy_2407
Enzymes [BR:chd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Calhy_2407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2520645..2521775)
Genome map
AA seq 376 aa AA seqDB search
MRIISKDANIKRILYQKGFDEKDILEFEKEANSIILRFDNIKNPSEFVQLLSNMGYFTVS
NGPIIFATTSFHNFEKTRCILAEEGIECSFDADFTISQRYLLAKDKQISLLKTNVMGIIN
VTPDSFYEGSRVQVEKVTQRALQMIQDGADVLDIGGESTRPFSEPVEEEEELKRVIPAIE
AIRDMDKNIPISIDTYKSRVAQKAIEAGADIINDISGGTFDKDMFYVAAQYNVPIVIMHI
KGTPKDMQKNPYYEDVVEEILQFFEERIEQAQKAGVKLENIILDPGIGFGKRPEDNLEIL
RRCEEFKVLGRPILIGASRKSVIGHVLGNLGPEERLEGTLAISVICVQKRIEFVRVHDVK
ENKRAILMTQAIFEGV
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
ttgaggataatatcaaaagacgcgaatataaaaagaattttatatcaaaaaggttttgat
gagaaagacattttggaatttgaaaaagaagcaaactcgataattttgagatttgataac
ataaaaaatccttcagaatttgttcagcttctttcaaacatgggttattttacagtttca
aatggtcctataatttttgcaacaacatcatttcacaactttgaaaagacaagatgtatt
ttagctgaggaagggatagagtgtagttttgatgcagattttaccatttcacaaagatat
ttgctggcaaaagataaacagataagccttttgaagacaaacgtgatggggattataaat
gtcacaccagactcgttttatgagggctcaagagttcaagttgaaaaggtaacccaaaga
gcactccagatgattcaagatggtgcagatgttctggacattggcggtgagtccacaaga
cctttttcagagccagttgaggaagaggaggagctaaaaagagtaattcctgcaattgaa
gcgataagagatatggataaaaatatcccaatttcaattgatacatataaaagcagagta
gctcaaaaagcaatagaagctggtgctgacattataaatgatatcagcggcgggacgttt
gacaaagacatgttttacgtggcagcgcagtataatgttcctatcgtaatcatgcacatc
aaaggtacaccaaaggatatgcagaaaaacccttactatgaagatgtcgtagaagagatt
ttgcagttttttgaagaaagaattgaacaggcacaaaaagctggtgtgaaacttgaaaac
atcatcttagaccctggcattggctttgggaaaagaccagaggacaacttggagatattg
cgaagatgtgaagagttcaaggttttaggaagacccattttgattggggcatccagaaaa
tcggtgattggccatgtgctcggtaatcttggacctgaggaaaggcttgaaggtactttg
gcaatctctgtaatatgtgttcaaaaaaggattgaatttgtaagggtgcatgatgtaaaa
gaaaataaaagagccatcttgatgacacaggctatcttcgaaggagtttaa

DBGET integrated database retrieval system