KEGG   Caldicellulosiruptor hydrothermalis: Calhy_2582Help
Entry
Calhy_2582        CDS       T01346                                 

Definition
helicase, recd/traa family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
chd  Caldicellulosiruptor hydrothermalis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:chd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Calhy_2582
Enzymes [BR:chd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Calhy_2582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2726866..2729091)
Genome map
AA seq 741 aa AA seqDB search
MQQNIQGMVSDIIYRNLENNYTVFEIICNDEVFTAVGIVPDIAIGEKVSVYGEFYVHPVY
GQQLKVSYLEKLLPQTKDEIYLYLSSGVIKGIGQKTAKKIVDTFGDDTARILQEEPEKLL
SIRGMTPEKVERIRNMFAFQKFLKDIMSIFSQYGFSQNHAMRLFKLYGFSALSLLQENPY
FLLDVFPELDFKKVDRLALDMGVMPDDRRRISAKILNLLTLAANNEGHTCLPENKLKQLC
IRTLDLPVEKIEEAIEALAQERRIVKDEVDSQEMVFLYGYYECERYIADKILSMLKEYDD
IADIDEKISSFEEKNGIAFSPNQKKAIKMALTQGVSIITGGPGTGKTTIIKCIIQIFEGE
GKKVFLCAPTGRAAKRMQAACERESKTIHRLLEMTVLDTHVIFQRGPNNPLKCDAIVVDE
MSMVDSFLMNYLLAATKPTTRIVLVGDKDQLPSVGAGNVLKDLIKSQIVPCTTLTEVYRQ
SENSFIVLNAHRINRGEFPHLQKESDFYFIQKNSQEEILKTVIELVTKKLPNYLSCDPMT
DIQVLCPSKKGIVGMYNLNRVLQQYLNPPHPSKKEYAYKENLFRVGDKVMQVKNNYSLEY
EIVQGEEKGRASTGIFNGDIGVVKDIDRSQGALEILFDDEKLVYYDFSLLDDLELAYAMT
VHKSQGSEFRCIVMPVVETYPILMTRNLLYTAVTRAKELVVLVGKKSALEYMIANQKEAM
RYSALCDFLLRGQSNMQLQVL
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaaaacattcagggcatggtaagtgatataatctacaggaatttggaaaacaac
tatacagtgtttgagataatctgtaacgatgaagtgttcacagcagtagggatagttcct
gatatagcaattggtgaaaaggtaagcgtgtacggtgagttttatgttcatcctgtttat
ggtcagcaacttaaagtaagctaccttgaaaagctattgccacagacaaaggatgagata
tatctttatctttcctctggagtgataaaaggtatcgggcaaaagactgcaaagaagatt
gttgatacctttggagatgacaccgcaaggattttgcaggaagagccagaaaagcttttg
agtattcgcggcatgacgcctgaaaaggttgagcggataaggaacatgtttgcgttccag
aaatttttgaaagatatcatgtcaatcttttcacagtacgggttttcacagaaccacgca
atgcgactttttaagctttatggattttctgctctgtcacttttgcaggaaaatccatat
tttcttttggatgtattcccggagcttgactttaaaaaggttgacaggcttgcacttgat
atgggagttatgccggatgacagaagaagaatatctgccaaaatactcaatcttttgaca
ttggcagcaaacaacgaagggcacacctgcctgccagaaaataagctcaaacagctctgt
atcagaacccttgaccttccagtggaaaaaatagaagaggcaattgaagctttagctcaa
gaaagaagaattgtgaaagatgaagttgactctcaagagatggtgtttttgtacggctac
tatgagtgtgaaaggtatatagcagacaaaatcctgtcaatgctaaaagagtatgatgac
attgctgatatagatgaaaaaatttcttcttttgaagaaaaaaacggtattgcattttcg
ccaaatcagaaaaaagctatcaagatggcgctgactcaaggtgttagcatcataacaggc
ggtcctggcacaggaaagaccacaatcataaaatgtatcattcagatttttgagggtgaa
ggcaaaaaggtttttctctgcgcaccaacaggaagagctgcaaagaggatgcaggcagcc
tgtgaaagagaatcaaaaacaatccacagacttttggagatgacagttttagacacacat
gttattttccaaagaggaccaaataatcccttaaaatgcgatgctatcgtggttgatgaa
atgagcatggtagacagtttccttatgaactatcttcttgctgcaacaaagccgacgaca
agaattgtccttgttggagacaaagaccagcttccatctgttggtgcaggaaatgtctta
aaagaccttataaaaagccagattgtgccgtgcacaactttgacagaggtgtatcgccag
agcgaaaatagttttatagttctcaacgctcataggataaacagaggtgagtttccacac
cttcaaaaggagagcgatttttattttatccagaaaaactctcaggaagagattttaaaa
actgtaattgagcttgtgaccaaaaaacttccaaactatctttcgtgcgacccgatgaca
gacatccaggttctgtgtccttccaaaaagggaattgtgggaatgtacaacctaaaccgc
gtgctgcagcagtacctcaacccacctcatccatctaaaaaggagtatgcctacaaggaa
aacctgttcagggttggcgacaaggtcatgcaagtgaaaaacaactattcgttggaatat
gagattgtacaaggagaggagaagggcagggcctcaacagggatattcaacggcgacatt
ggagttgtaaaggatatcgacaggtctcaaggtgctttggagattttgtttgacgatgaa
aagcttgtgtattatgacttttcgctgcttgacgacttagagcttgcatatgccatgact
gttcacaaatcacagggctcagagtttaggtgcatagtgatgccggttgttgagacctac
cccattttgatgacaagaaaccttctttacactgctgttacacgagcaaaagaacttgtt
gtgctggtgggtaaaaaaagcgccttagagtatatgatagcaaaccagaaagaagctatg
cgatattcagcactttgcgactttttactgcgcgggcaatcaaatatgcaattgcaagtt
ttatga

DBGET integrated database retrieval system