KEGG   Caldicellulosiruptor hydrothermalis: Calhy_2611Help
Entry
Calhy_2611        CDS       T01346                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
chd  Caldicellulosiruptor hydrothermalis
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:chd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Calhy_2611
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Calhy_2611
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Calhy_2611
Enzymes [BR:chd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Calhy_2611
Exosome [BR:chd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Calhy_2611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2755243..2756892
Genome map
AA seq 549 aa AA seqDB search
MKRFFMQRKNLIVSAILILCLILSTLAFAQQEQDENQQKVKNVILMIPDGMTIAHTTLSR
WYQGGEPLSMDEIACGLVKTYSANNPITDSAPAATAYATGYKTQNRYISIYPEMVSMPGV
GQVEEKDFYKPIVTILEAAKKVGKSTGLVFTCQFPHATPAAFASHTDNRNDYESIAEQMV
YNQVDVVLGGGYKYIDKNQRKDKEDLAGYLKQNGFFVTTSWQEAKNFSGKKIWGLFAQDA
MHYDFDRNGTGEPSLAEMTQKALQILSKNRNGFFLMVEGSEIDWASHANDPVGVVSEVLA
FDKAVKVALDFAKSRDDTAVIIASDHANGGMSLGNYTTKYDTALLNDFLAYITKAKRTGA
GIEEHLGNNKTDENIKKIVSEYYGINDLTSDEINAIKNAKAGNLNYVLGPIISKRSNIGW
TSNGHTGEEVVLYAYHPNGYIPRGVIDNTEICDYMAEILGIDLGSFNENAYISNIDLEEK
GYDVSIDTINPSNVQLVINKGSKTYIIPQNKNVVLEGSNQYKLKYVSVYIPSAKRFFVSS
EIESLIKLP
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagattttttatgcaaagaaaaaacctcattgtttctgccattttgattctatgc
ttgattttatcaacacttgcatttgcgcagcaggagcaagatgaaaaccaacaaaaggtc
aaaaacgtcattttgatgattcccgatggtatgacaatagctcacacaacgctttcgcgc
tggtaccaaggtggagaacccttgtcaatggatgagattgcctgtggacttgtgaaaaca
tattcagcaaacaatccaattacagactcagcaccagctgcaacagcttatgccacggga
tacaaaacacaaaacaggtatatttcaatctaccctgagatggtctcaatgccaggtgta
ggccaggtagaagaaaaagatttttacaagccaatagtaacaatattagaagctgcaaaa
aaagtaggaaagtcaacaggtcttgttttcacatgccagttcccacacgcaacacctgct
gcgtttgcctcgcacacagataaccgaaatgactatgaatcaatagcagagcagatggtt
tacaaccaggttgatgttgtgctcggtggagggtacaaatacatcgacaaaaatcagaga
aaagacaaggaagatttggcaggttacctcaaacaaaacggcttttttgtcacaacaagc
tggcaggaagcaaaaaacttttcaggaaagaaaatctggggactttttgcccaggatgca
atgcactatgattttgacagaaatggcacaggtgaaccgtctttagcagagatgactcaa
aaggcactccagattctgtccaagaatagaaacgggtttttcttgatggtagaaggcagt
gaaattgactgggcatcacatgcaaacgaccctgttggtgttgtgtctgaggttttggca
tttgacaaggcagtaaaggtagctttggattttgcaaagtcaagagatgacacagcggta
attattgcatctgaccatgcaaatggaggcatgagcttaggaaattacacaacaaagtat
gacacagcactattaaatgatttccttgcatacatcacaaaagctaaaagaactggtgca
ggtattgaagaacatctcggaaacaataagacagatgaaaatattaaaaaaatagtatct
gaatactacggaattaatgacctaacatcagatgaaataaatgccatcaaaaatgctaag
gcaggaaatctaaactatgtattaggtccgataataagcaaaaggtctaatattggctgg
acatcaaatggccatacaggtgaagaggtagttttatatgcatatcacccaaatggatac
atcccaagaggagtcattgacaacacagagatttgcgactatatggcagagattcttggt
atcgaccttggaagctttaatgaaaatgcgtatatttcaaacattgacttagaagaaaaa
ggatatgatgtttccattgacacaatcaacccgtcaaacgtccagcttgtgataaacaaa
ggaagcaaaacgtacatcatcccgcaaaacaaaaatgtggtcttagaaggttctaatcag
tacaagttaaaatatgtaagtgtgtatattccaagcgcgaaaaggttctttgtatcaagc
gagatagaaagtctgattaaattaccctaa

DBGET integrated database retrieval system