KEGG   Cardinium endosymbiont cEper1 of Encarsia pergandiella: CAHE_0101Help
Entry
CAHE_0101         CDS       T02243                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA (EC:3.6.4.12)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
che  Cardinium endosymbiont cEper1 of Encarsia pergandiella
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:che03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(102133..102732)
Genome map
AA seq 199 aa AA seqDB search
MIAQLIGQLLYKEPTYVILNVGGVGYGLHISLYTFDQIKTLDNCSLLTVMQVKNEAATLY
GFYTLEEKSWWLQLISVGSIGPRIALTILSSLNPAALHKAILRKDERLLISIKGVGAKAA
QRLILELSDKAQKLHDIQDTLVPQPIESKVDQDAIMALTKLGLTQKVAEKAIATVRAETL
TPLSLEELIKKALQPHAFK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgattgcacaacttataggacaattattatataaggagcccacttatgtcattttaaat
gtagggggagtagggtatggcttgcatatttctttatatacttttgatcaaataaagact
ttagataattgtagcttgttgacggttatgcaagtaaaaaatgaagcggctaccttatat
ggtttttatacattagaagaaaaatcatggtggttacagcttatctctgttggtagcatt
ggtcctaggattgccctgaccatcttatcttcgctcaatccagctgctttacataaagct
attttacgtaaagatgaacgtttgcttatctccattaaaggcgttggcgcaaaagctgcg
caacgattgatactagaactctcggataaagcccaaaagttgcatgatatccaagatacc
ttggtaccacaaccaatcgaaagcaaagtagatcaagatgccataatggctttaactaaa
ttagggcttacccaaaaagttgcagaaaaggccattgcaacggtacgggcagagacactg
accccacttagcctcgaagaacttattaaaaaagcgttgcagccacatgcctttaaataa

DBGET integrated database retrieval system