KEGG   Cardinium endosymbiont cEper1 (Encarsia pergandiella): CAHE_0101Help
Entry
CAHE_0101         CDS       T02243                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA (EC:3.6.4.12)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
che  Cardinium endosymbiont cEper1 (Encarsia pergandiella)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:che00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CAHE_0101 (ruvA)
Enzymes [BR:che01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CAHE_0101 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(102133..102732)
Genome map
AA seq 199 aa AA seqDB search
MIAQLIGQLLYKEPTYVILNVGGVGYGLHISLYTFDQIKTLDNCSLLTVMQVKNEAATLY
GFYTLEEKSWWLQLISVGSIGPRIALTILSSLNPAALHKAILRKDERLLISIKGVGAKAA
QRLILELSDKAQKLHDIQDTLVPQPIESKVDQDAIMALTKLGLTQKVAEKAIATVRAETL
TPLSLEELIKKALQPHAFK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgattgcacaacttataggacaattattatataaggagcccacttatgtcattttaaat
gtagggggagtagggtatggcttgcatatttctttatatacttttgatcaaataaagact
ttagataattgtagcttgttgacggttatgcaagtaaaaaatgaagcggctaccttatat
ggtttttatacattagaagaaaaatcatggtggttacagcttatctctgttggtagcatt
ggtcctaggattgccctgaccatcttatcttcgctcaatccagctgctttacataaagct
attttacgtaaagatgaacgtttgcttatctccattaaaggcgttggcgcaaaagctgcg
caacgattgatactagaactctcggataaagcccaaaagttgcatgatatccaagatacc
ttggtaccacaaccaatcgaaagcaaagtagatcaagatgccataatggctttaactaaa
ttagggcttacccaaaaagttgcagaaaaggccattgcaacggtacgggcagagacactg
accccacttagcctcgaagaacttattaaaaaagcgttgcagccacatgcctttaaataa

DBGET integrated database retrieval system