KEGG   Cardinium endosymbiont cEper1 of Encarsia pergandiella: CAHE_0107Help
Entry
CAHE_0107         CDS       T02243                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
che  Cardinium endosymbiont cEper1 of Encarsia pergandiella
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:che00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:che00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
110555..111103
Genome map
AA seq 182 aa AA seqDB search
MPLEAPYLSGLLLFKPDVFYDERGYFFESYHQEKYKAIGLEAAFVQENQSLSKKGTVRGL
HYQLAPYGQAKLVRVVEGVIWDVVVDLRKKMDTFGKWQGFLLSSENNHQLFVPVGCAHGF
IALSNKAIVAYKCDGYYCPNAEKGIHFNDPTLNIPWEDYGKPEIISAKDAALPLFQEATY
TF
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgccattagaagcaccatacctttcaggcctgttactatttaagcctgatgtattttac
gatgaaaggggctatttttttgaatcttaccatcaagaaaaatacaaagcaataggctta
gaggctgcttttgtacaagagaatcaatctttatctaaaaaaggaaccgttcgtggcctc
cattatcaattggcgccttatggacaagccaaattggtacgggtggtagagggtgttata
tgggatgtagtagtagacttacgtaaaaaaatggatacttttggcaaatggcaaggtttt
ttactttcttcagaaaacaaccatcagctttttgtaccggtaggttgtgcgcatggcttt
atagctttaagcaataaggctatagtagcttataagtgcgatggctattattgcccaaat
gcagaaaaaggcattcattttaatgatcccacattaaatattccttgggaagattatggg
aaaccggaaattatttcagcaaaagatgccgctttacccctattccaagaagcaacctat
accttttag

DBGET integrated database retrieval system