KEGG   Cardinium endosymbiont cEper1 (Encarsia pergandiella): CAHE_0169Help
Entry
CAHE_0169         CDS       T02243                                 

Gene name
bfmBB
Definition
lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex (EC:2.3.1.168)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
che  Cardinium endosymbiont cEper1 (Encarsia pergandiella)
Pathway
Citrate cycle (TCA cycle)
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:che00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CAHE_0169 (bfmBB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CAHE_0169 (bfmBB)
  Amino acid metabolism
   00310 Lysine degradation
    CAHE_0169 (bfmBB)
Enzymes [BR:che01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CAHE_0169 (bfmBB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(165955..167223)
Genome map
AA seq 422 aa AA seqDB search
MSLITLYLPKMGESVIEVVVLDWCIQEGEAVVEGAPLLGVATDKVDAEIPATYTGTIKKL
LVKKGDVLAIGAPIALLEVDHLDVPPVLHQPENAKPSLVAIPRHLEPSVLAIHPFKKVKL
SPLASHIAQANAIQADELAKLAGYTRDHRVTKEALLNYISKRLPIHTSSSERPLFCEALI
PLAGDEVVQMDRVRKLIADRMVQSKKIAPHVTSFIRADVTELVAWRQQHKISFEAKYGAR
LTYNPIFIAVIARALQLFPLLNAVVVNDHIIKRKHINIGFAVARSDGNLLVPVVKQVEQL
GLVALAQQIDGLIDQARNGTIMPDALTGASYTISNIGSFDNLMGTPIIVQPQVAILALGL
IEKRPAVVHVKGNETIAIRDELFLSHTYDHRIIDGAIGGGFLKYLAKALASFVAEIDTYP
FI
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtctttaataacgctttacttacctaagatgggggaaagtgtcatagaagttgtagta
ttggattggtgtatacaagagggagaagccgttgtggaaggtgcacctcttttaggggtt
gctacggataaggtagatgcagagattcctgctacttacacaggtacaattaaaaaatta
ttggtaaaaaaaggagacgtattggccattggcgcacctatcgctttattagaagtagac
catttagatgtgccacctgttctacatcaacctgaaaatgccaagccttcgttagtagct
atcccccgccatttagagcctagtgtgttggctatccatccttttaaaaaggtaaaatta
agtcctttggccagtcatattgctcaagcaaatgccattcaagcagatgaactagcaaag
ttagccggatatactcgggatcatcgggttactaaagaagcccttctgaactatataagc
aaacgcctacccatccatactagtagttcggagcgccctctattttgtgaagcgcttatc
cctctagcaggtgatgaagtggtacaaatggatcgtgttagaaagctaattgcagatcgt
atggtgcaatctaagaaaattgccccccatgttacctcctttatacgtgctgatgtaacc
gaacttgttgcctggaggcagcagcataaaatttcttttgaagcaaaatatggtgctaga
ttgacctataatcctatttttatagccgtaattgcacgtgcgctccaactatttccactt
ctgaatgcggtagtcgtgaacgatcatattattaaacgcaaacatattaatataggtttt
gctgtagcccgctcagatggaaatctattggttcctgtagtcaagcaagtagaacagctt
ggtttggttgcattggcacaacaaatcgatgggttgattgatcaagcacgcaacggtacc
attatgccagatgcattaacgggtgccagttacactatttctaatattggttcctttgat
aatctcatgggaacccctatcatcgtgcaaccacaggtagccattcttgcattgggtctt
attgaaaaacgtcctgctgtggtccatgttaagggaaacgaaaccatagcgattcgcgat
gaactgtttctatcccatacctatgatcatcgaattatagatggcgcgataggaggagga
tttttaaaatatttggcgaaagcattggcctcttttgtagccgagatagacacctatcca
tttatatga

DBGET integrated database retrieval system