KEGG   Cardinium endosymbiont cEper1 (Encarsia pergandiella): CAHE_0169Help
Entry
CAHE_0169         CDS       T02243                                 

Gene name
bfmBB
Definition
lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex (EC:2.3.1.168)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
che  Cardinium endosymbiont cEper1 (Encarsia pergandiella)
Pathway
Citrate cycle (TCA cycle)
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:che00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CAHE_0169 (bfmBB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CAHE_0169 (bfmBB)
  Amino acid metabolism
   00310 Lysine degradation
    CAHE_0169 (bfmBB)
Enzymes [BR:che01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CAHE_0169 (bfmBB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(165955..167223)
Genome map
AA seq 422 aa AA seqDB search
MSLITLYLPKMGESVIEVVVLDWCIQEGEAVVEGAPLLGVATDKVDAEIPATYTGTIKKL
LVKKGDVLAIGAPIALLEVDHLDVPPVLHQPENAKPSLVAIPRHLEPSVLAIHPFKKVKL
SPLASHIAQANAIQADELAKLAGYTRDHRVTKEALLNYISKRLPIHTSSSERPLFCEALI
PLAGDEVVQMDRVRKLIADRMVQSKKIAPHVTSFIRADVTELVAWRQQHKISFEAKYGAR
LTYNPIFIAVIARALQLFPLLNAVVVNDHIIKRKHINIGFAVARSDGNLLVPVVKQVEQL
GLVALAQQIDGLIDQARNGTIMPDALTGASYTISNIGSFDNLMGTPIIVQPQVAILALGL
IEKRPAVVHVKGNETIAIRDELFLSHTYDHRIIDGAIGGGFLKYLAKALASFVAEIDTYP
FI
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtctttaataacgctttacttacctaagatgggggaaagtgtcatagaagttgtagta
ttggattggtgtatacaagagggagaagccgttgtggaaggtgcacctcttttaggggtt
gctacggataaggtagatgcagagattcctgctacttacacaggtacaattaaaaaatta
ttggtaaaaaaaggagacgtattggccattggcgcacctatcgctttattagaagtagac
catttagatgtgccacctgttctacatcaacctgaaaatgccaagccttcgttagtagct
atcccccgccatttagagcctagtgtgttggctatccatccttttaaaaaggtaaaatta
agtcctttggccagtcatattgctcaagcaaatgccattcaagcagatgaactagcaaag
ttagccggatatactcgggatcatcgggttactaaagaagcccttctgaactatataagc
aaacgcctacccatccatactagtagttcggagcgccctctattttgtgaagcgcttatc
cctctagcaggtgatgaagtggtacaaatggatcgtgttagaaagctaattgcagatcgt
atggtgcaatctaagaaaattgccccccatgttacctcctttatacgtgctgatgtaacc
gaacttgttgcctggaggcagcagcataaaatttcttttgaagcaaaatatggtgctaga
ttgacctataatcctatttttatagccgtaattgcacgtgcgctccaactatttccactt
ctgaatgcggtagtcgtgaacgatcatattattaaacgcaaacatattaatataggtttt
gctgtagcccgctcagatggaaatctattggttcctgtagtcaagcaagtagaacagctt
ggtttggttgcattggcacaacaaatcgatgggttgattgatcaagcacgcaacggtacc
attatgccagatgcattaacgggtgccagttacactatttctaatattggttcctttgat
aatctcatgggaacccctatcatcgtgcaaccacaggtagccattcttgcattgggtctt
attgaaaaacgtcctgctgtggtccatgttaagggaaacgaaaccatagcgattcgcgat
gaactgtttctatcccatacctatgatcatcgaattatagatggcgcgataggaggagga
tttttaaaatatttggcgaaagcattggcctcttttgtagccgagatagacacctatcca
tttatatga

DBGET integrated database retrieval system