KEGG   Cardinium endosymbiont cEper1 of Encarsia pergandiella: CAHE_0351Help
Entry
CAHE_0351         CDS       T02243                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
che  Cardinium endosymbiont cEper1 of Encarsia pergandiella
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:che00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:che00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
360692..362164
Genome map
AA seq 490 aa AA seqDB search
MHHLQQLLVGISVKKIWGSTDLSVQSICFDSRKAVPHSCFIAINGSQLDGHGYISMAIAA
GSSVVVCEWLPESIQENITYIVVYSTAKALGIMAANFYEQPSKKLTLVAVTGTNGKTTIV
HLLYHVVRKMGYKAGMFSTIYNKVLDQTYPASHTTPDPLQLQSFLHLMVASGCQYCFMEA
SSHAIVQERLAGLYFRGAIFTNITHEHLDYHLNFSQYIQAKKKLFDHLPATAFALMNQQD
KHSPVLLQNCKAQKFTFSLRDVADFRAKIVTNTLHGLELALPLAHQSIWFQLLGAFNASN
LLAAYGTAQLLGLNNEESLVALSAIPPVLGRMNRVHHGKSQQVIIDYAHTPDALQKVMDT
LHAIRPAGSRLIAIMGCGGNRDQQKRAIIGKILSQNSDIAIFTSDNPRQEDPQEIINAMQ
QGVPKAAFPKVLHIVDRAMAIKTACLLAHANDLILIAGKGHQYYEEIKGIKYPFFEAKIV
QEILGDAKAV
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgcaccatcttcaacagcttctagtaggtatttctgtaaaaaaaatatggggttcaact
gacctatctgtacaaagtatttgttttgatagccgtaaagcagtaccccattcttgtttt
attgctataaatggtagccaattggatggacatggctacatatcaatggccatagcagca
ggtagtagcgttgttgtatgcgaatggctgcctgagtcgattcaggaaaatataacctat
atagtggtctattctaccgctaaagcactggggatcatggctgctaatttttacgaacag
cccagtaaaaaactaactttggtagcagttactggtacaaatggtaaaaccactattgta
cacttattgtatcatgtggtgcgcaaaatgggctataaagctggtatgttttctactata
tacaataaggttttagatcaaacctatcccgctagccataccacgccagatcctttgcaa
ttgcagtcattcttgcatcttatggtagcatcgggttgccaatattgttttatggaagca
agttcacatgctatagtccaagaaaggttagcaggcctctattttagaggtgctattttt
accaatattacccatgaacatttggactatcatcttaacttttcacaatatattcaggct
aaaaaaaaactatttgaccatttgcctgctactgcttttgcccttatgaaccagcaagac
aaacacagtccggtactgcttcagaattgtaaggctcaaaagtttactttttcacttcga
gacgttgctgattttagagcaaaaatagtgaccaatactttacatgggctagagttagcc
ttacccttagcccatcaatcgatatggtttcaactactgggtgcatttaatgccagtaat
ctgttggctgcttatggtaccgctcagttattgggattaaacaacgaagaaagtttggta
gcgctttcagcaattcctcctgttttgggaagaatgaatcgggtgcaccatggaaaatcg
caacaagttataatagactatgcccatacgccagatgcccttcaaaaagtaatggatacg
ttgcatgccatccgccctgctggcagcaggcttattgccattatggggtgtggaggcaat
cgtgaccaacaaaaacgggcaatcattggaaagattctatctcaaaatagtgatatcgct
atatttacgagtgataatccaagacaagaagatccacaagaaattatcaatgcgatgcaa
caaggtgtacctaaagcagcctttccgaaagtgctccatatcgtagatagagcgatggcg
attaaaacagcttgtttactggcgcacgcaaacgatctaattttaatagcagggaaaggc
catcaatattatgaagaaatcaaagggataaaatatcctttttttgaagcaaaaattgtt
caagaaattttgggcgatgcaaaagcagtttag

DBGET integrated database retrieval system