KEGG   Cardinium endosymbiont cEper1 (Encarsia pergandiella): CAHE_0731Help
Entry
CAHE_0731         CDS       T02243                                 

Gene name
gpx1
Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
che  Cardinium endosymbiont cEper1 (Encarsia pergandiella)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:che00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CAHE_0731 (gpx1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CAHE_0731 (gpx1)
Enzymes [BR:che01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CAHE_0731 (gpx1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
751448..751942
Genome map
AA seq 164 aa AA seqDB search
MDTHTNPHKDFSFTLLDGTTFHLCSGQVVLVVNTASRCGFARQFDALQRLHDRYHMHGFT
VLGVSSQSFGKQEFEKPCDIATAIQNKSSGLTFPITQLTAVRGKSIHPFYAWAATQVSWC
GRPKWNFHKYLIGKEGQCITWFASATDPLAPKVIETVEAALGNH
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggatacacataccaaccctcataaagatttttcgtttaccctattagatggcactacg
tttcatctttgtagtgggcaggtagttttagtagtcaatacagcttcgcgctgtggattt
gcccgtcaattcgatgccttacaaaggctgcatgatcgctaccatatgcatggttttaca
gtgcttggggtatcttctcaaagttttggcaagcaagaatttgaaaagccttgtgatata
gcaactgctatacaaaacaaatcaagtggccttacttttccgattacgcagttaacagct
gtgcgtggaaaatccattcatccattttatgcatgggctgctacacaagtttcttggtgt
ggacgcccaaaatggaactttcataaatacttgatagggaaagagggtcaatgcattaca
tggtttgcttctgcaacagatcctttagccccaaaggtcatagaaacggtagaggctgca
ctagggaaccactag

DBGET integrated database retrieval system