KEGG   Cardinium endosymbiont cEper1 (Encarsia pergandiella): CAHE_0765Help
Entry
CAHE_0765         CDS       T02243                                 

Gene name
Acss2
Definition
acetyl-coenzyme A synthetase, cytoplasmic (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
che  Cardinium endosymbiont cEper1 (Encarsia pergandiella)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:che00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CAHE_0765 (Acss2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CAHE_0765 (Acss2)
   00620 Pyruvate metabolism
    CAHE_0765 (Acss2)
   00640 Propanoate metabolism
    CAHE_0765 (Acss2)
  Energy metabolism
   00680 Methane metabolism
    CAHE_0765 (Acss2)
Enzymes [BR:che01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     CAHE_0765 (Acss2)
Lipid biosynthesis proteins [BR:che01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   CAHE_0765 (Acss2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
797132..799132
Genome map
AA seq 666 aa AA seqDB search
MKSPTTDSVYLPSDAIQKRAYIPSLDAYLKIYNGSIKDPGKFWEKIATDFFWKTKPVGPF
LNYNFDLNKGNIFIKWMEGATTNICYNLVDKPIQDGYGDKIAYYWEGNEPGEQKQITYQA
LLKAICKCANVLKDLGIKKGDRVAIYMPNTIEAIVAMLSCARIGAIHVVVFAGFSANALA
ERIIAAQAKLLITADGTFRGTKFIALKSIATQALMQCKAAGHPLNHCMVFNRLQTTQQIP
EIPWNDAIDCAWEKLMASASELCTPEWVDGEDPLFILYTSGSTGKPKGVLHTTGGYLLYT
ATVFKYAFDYHPEDIFFCSGDLGWITGHTFNVYGALACKSTSVIFDGIPTYPDGGRFWDL
IDRYKVTTFYTAPTAIRTLMQLPASYVTKYSRASLRILGSVGEPIDPSSWRWFYEVVGSS
RCPIIDTFWQTETGAPIICPLPGSTPLKPGSATLPFWGIVPTIVDEDGIEVIGPGKGHLV
IKNPWPGMARTLDRDHQRFQATYFEPYHGYYYTGDGAERDADGYFWITGRTDDMLNCSGH
LISTAEIESVLMQHPSVAEAAAVSALHAIKGESIHCFIVLKDGQIYNHTIEYEIKSMIRN
QIGAFAVPDLIEPVPALPKVGSGKIMRRLLRKIVRKEGYLGDTSTLVDPNIIDQLRALTL
NNTKML
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagccctacaactgattcagtctatcttccttctgatgccattcagaaaagagcc
tatattccatcattggatgcatatctaaaaatatataacggctccattaaagatccgggg
aagttttgggaaaaaatagctacagattttttttggaaaaccaaaccggtgggtccattt
ctaaactataattttgacctaaacaagggaaatatttttataaaatggatggaaggcgct
actaccaacatttgttataacctggtagacaaaccaattcaggatggctatggagacaag
attgcctattattgggaaggcaatgagccaggtgaacaaaagcaaatcacctaccaagcg
ctgctaaaggctatttgtaaatgtgccaatgttttaaaagatctggggataaaaaaggga
gaccgggtagccatttatatgccgaataccatagaggcgatcgtagccatgttaagttgt
gcgcggattggtgcgatccacgttgttgtttttgcaggattctcagcaaacgcactagca
gaacgaatcatagcagcacaagcaaaactcttgataacagctgatggaacattccggggc
acaaagtttattgccctcaaatccatcgcaacccaagcattgatgcaatgtaaggcagct
ggtcacccactgaaccattgtatggtgtttaatcgcttgcagactacccaacaaatacct
gagattccttggaatgacgctatagattgcgcctgggaaaaattgatggcgtctgcatca
gagctatgtacacctgagtgggtggatggggaagatccgctatttatactttatacaagt
ggttcaactggcaaaccaaagggtgtgctccatacaactggcggatacctgttatatact
gcaacggtatttaaatatgcctttgattaccacccagaagatatatttttttgttctgga
gatttaggctggattacaggtcatacttttaatgtgtacggtgcactggcctgtaaaagc
acttctgttatatttgacggtattccaacctatccagatgggggacgcttctgggatttg
attgatcggtataaggtaacgacattttatacagcgcctacagcgattcgaacccttatg
caactgcctgcttcatatgtaacaaaatatagtagagcctctttgcgcatactgggttca
gtgggagaacctattgatccttcatcttggcgctggttttacgaagtagtgggatcaagt
cgctgtcccatcattgataccttttggcagacagaaacaggcgcgcccattatttgtcca
cttcctggatctacaccattaaagcctggctctgccacacttcccttttgggggattgta
cccacaatcgttgatgaggatggtattgaagttataggtccaggaaaaggccaccttgtg
atcaaaaatccctggccagggatggcaaggacactggacagagatcatcagcgctttcaa
gccacctattttgagccataccatggatattactatacaggagatggtgcagaacgtgat
gcagatggctatttttggataacaggtagaacagatgatatgctgaattgctccggtcac
ttgatatcaaccgctgaaattgaatccgtactgatgcaacatccctcggtagcagaagcg
gctgccgtatcggccctacatgctataaaaggcgaatccatccattgttttattgtatta
aaagatgggcaaatatataatcacacaattgaatatgagatcaaatcaatgatccgaaac
caaataggggcttttgccgttccggacctgatagaacctgtaccggcgctgcctaaagtt
ggctctggaaaaataatgcgtcgactgctcagaaaaatagtacgaaaagaaggctattta
ggtgacacctccacactagtggaccccaatattattgaccagctccgcgcacttacttta
aataacactaagatgctgtaa

DBGET integrated database retrieval system