KEGG   Cardinium endosymbiont cEper1 (Encarsia pergandiella): CAHE_0780Help
Entry
CAHE_0780         CDS       T02243                                 

Gene name
dfrA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
che  Cardinium endosymbiont cEper1 (Encarsia pergandiella)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:che00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CAHE_0780 (dfrA)
   00670 One carbon pool by folate
    CAHE_0780 (dfrA)
Enzymes [BR:che01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CAHE_0780 (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(814363..814860)
Genome map
AA seq 165 aa AA seqDB search
MIISIIVAMSLNRVIGKKNKLPWHLPADLKEFKKKTLGHHLLMGSHTFRSIGSILPGRIS
IVVSTKMDRSVVGYHVVRSIEEAISLAKEQGASELFVIGGEKIYEQTLALAHKIYLTRIH
LMVSGDTYFPLIGDEWVERTIGSFKADHKNPYDYEFILLEKETIR
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgattatatctattattgtcgcgatgtctttaaatagggtgattggcaagaaaaataag
cttccttggcatcttcctgctgatttgaaagagtttaaaaaaaaaacattaggacatcat
ttgctaatgggtagccatacttttcgttccattgggtctattttacccggtcggattagt
atagtagttagtacaaaaatggatcggtctgttgtgggttatcatgtagtacgcagtatt
gaggaggcgataagcttagcaaaagagcaaggcgcgtcggaattgtttgtcattggaggg
gaaaaaatttacgaacaaacgttagctttagcccataaaatttacctgacaagaatccat
ctgatggtatcaggagatacctatttccctttgataggggacgaatgggtcgaacgtacc
atcggttcttttaaagcagatcataaaaacccttatgattatgaatttattctattagaa
aaagaaacaatacgataa

DBGET integrated database retrieval system