KEGG   Chlamydia psittaci 02DC15: CPS0B_0460Help
Entry
CPS0B_0460        CDS       T01861                                 

Gene name
sucB
Definition
dihydrolipoamide acetyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
chi  Chlamydia psittaci 02DC15
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:chi01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:chi00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:chi00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
473203..474300
Genome map
AA seq 365 aa AA seqDB search
MITEVRIPNVAESISEVTIASLLVTSESLVQENQGIMEIESDKVNQLIYAPISGRIVWSV
AEGDVVAVGGIVATIYDANESVSESTAKETPVEETVDAEIINFPRSTAHNPPSEGKTFVP
LREKMQEEPQRSGAKNEVRERMSSIRKTISRRLVTALHESAMLTTFNEIHMTPLMQLRKE
KQEAFSSRYNVKLGLMSFFIKAVIEALKAYPRVNAYIDGDEIVYRQYYDISIAVGTERGL
VVPVIRECDKLSSGDIEVKLADLASRARDGLISLPELEGGSFTITNGGVYGSLLSTPIIN
PPQVGILGMHKIEKRPVVIDNTIAIADMMYVAFSYDHRIIDGKEAVGFLIKIKDAIEQPE
GLLDF
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgatcacagaagtacgcattccaaatgtcgctgaatccataagcgaagtcaccatagct
tctcttttggtgacttcagagagtctggttcaggagaatcaaggtattatggagatcgaa
agcgataaggtaaatcaacttatctatgctcctatatcgggaaggatcgtttggtctgtc
gctgaaggagacgttgttgccgtcggtggaatcgttgctacgatctatgatgctaatgaa
tctgtttccgaaagtacagcgaaggaaactccggtagaggagacagtagatgcggagatt
attaatttcccgaggtctacagctcacaatcctccttctgagggaaaaacatttgttcct
ttacgtgagaaaatgcaagaagaaccgcaacgttcgggagctaaaaatgaggttcgtgag
cgtatgtcatccatacgcaaaacgatttctcgacgtttagttacagctcttcatgaatca
gcaatgttaacaacattcaatgagattcatatgacccctctgatgcaacttcggaaggaa
aaacaagaggccttttcttctcgctataatgtgaaactcggtttgatgtcctttttcata
aaagcagttattgaagctctgaaggcttatccccgtgtaaatgcgtatattgatggcgat
gaaattgtctatcgtcagtattacgatatttccattgctgtaggaacagaacgcggtctt
gttgtccctgtgattcgtgagtgcgataaactctctagtggcgatatcgaagtgaaactt
gcagatttggcaagtagagctcgagatggtttaatttctcttccagagttagaaggagga
agtttcactattaccaatggtggggtgtatggttccttactttctacgccgattatcaat
cctcctcaagtggggatattgggaatgcacaaaatagaaaaacgccctgtagtgatcgat
aatacaatcgccattgcggatatgatgtatgttgcctttagctacgaccatcgtatcatc
gatggtaaagaggcggttggtttccttatcaaaatcaaagatgctatagaacaaccagaa
gggttacttgatttttaa

DBGET integrated database retrieval system