KEGG   Chlamydia psittaci 02DC15: CPS0B_0967Help
Entry
CPS0B_0967        CDS       T01861                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
chi  Chlamydia psittaci 02DC15
Pathway
chi00010  Glycolysis / Gluconeogenesis
chi00260  Glycine, serine and threonine metabolism
chi00680  Methane metabolism
chi01100  Metabolic pathways
chi01110  Biosynthesis of secondary metabolites
chi01120  Microbial metabolism in diverse environments
chi01130  Biosynthesis of antibiotics
chi01200  Carbon metabolism
chi01230  Biosynthesis of amino acids
Module
chi_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:chi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPS0B_0967
  Energy metabolism
   00680 Methane metabolism
    CPS0B_0967
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CPS0B_0967
Enzymes [BR:chi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CPS0B_0967
Membrane trafficking [BR:chi04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CPS0B_0967
Exosome [BR:chi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CPS0B_0967
  Exosomal proteins of melanoma cells
   CPS0B_0967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEG87880
Position
1043812..1044495
Genome map
AA seq 227 aa AA seqDB search
MAFLILLRHGKSVWNEKNLFTGWVDIPLSQKGIDEAMLAGEAIKDLPIDCIFTSSLVRSL
MTALLAMTHHNSKKIPYIVHDDPQHKHMSKIYSDEANHMIPLYRSSALNERMYGELQGKN
KKETAEQFGEEQVKLWRRSYKTAPPKGESLYDTGQRTIPYFHETIFPLLQNSKNVFVSAH
GNSLRSLIMDIEKLSEEEVISLELPTGKPIVYLWTGHTFERHPEPFG
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcctttcttatcttattacgacacggaaaatccgtctggaatgaaaaaaaccttttt
acaggatgggtggatatccccctgagtcaaaaaggtattgacgaagcaatgcttgcaggc
gaggcaatcaaagacctccccatagattgtatctttacctcctctcttgtgaggagttta
atgacggcattgcttgctatgacacatcacaattctaaaaaaatcccttacattgttcat
gatgatcctcaacacaagcacatgagcaagatctatagtgatgaagcaaaccacatgatc
ccgctttaccgttccagtgcactaaatgaaagaatgtacggagagctccaaggaaaaaat
aaaaaagaaaccgctgagcaatttggagaggagcaggtaaaattgtggagacgtagttat
aagactgcccctcctaaaggcgaaagtctttacgatactgggcaacgcactatcccctat
tttcatgaaactattttccctttgttgcaaaattcaaaaaatgtgtttgtgtctgcacat
ggaaattcattacgttcactcatcatggatatagaaaaattaagtgaagaagaggtaatc
tctttggagttacccacaggaaaacccatagtgtatttatggaccggtcacacattcgaa
cgacacccagaaccatttggttaa

DBGET integrated database retrieval system