KEGG   Chlamydia psittaci 02DC15: CPS0B_1066Help
Entry
CPS0B_1066        CDS       T01861                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
chi  Chlamydia psittaci 02DC15
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:chi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CPS0B_1066
   00670 One carbon pool by folate
    CPS0B_1066
Enzymes [BR:chi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CPS0B_1066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1157446..1157889)
Genome map
AA seq 147 aa AA seqDB search
MGKQGKLPWNYPEDIEFFSKTIGNHVLIMGRKTSEGLPDKYKKNRKIIVFSRDYHESFEN
VIWVSSLEEFRRLEQLSSIFLIGGGELFSLFLENRMVDGCFITHIHKCYEGDVFFPLSLI
KGWRKTVLDEKENLTFCFYENFADCHS
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagcaaggaaagcttccgtggaactatcctgaagatatcgaatttttttccaaa
actataggaaatcatgtcctaatcatggggagaaagacttctgagggtcttcctgataag
tataagaagaaccggaagattattgtcttttccagggattatcatgaaagtttcgagaat
gtaatctgggtatcttctttagaggaatttagacgtttagaacaactttcttctattttt
cttattggcggaggagaattgttttctttatttttagaaaatcggatggtggatgggtgt
ttcataactcatattcacaagtgttatgagggtgatgttttcttccctctatctttaatc
aaagggtggaggaaaactgttttagatgagaaagagaacttaacattttgtttttatgaa
aatttcgccgattgtcactcgtag

DBGET integrated database retrieval system