KEGG   Chlamydia psittaci 02DC15: CPS0B_1073Help
Entry
CPS0B_1073        CDS       T01861                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
chi  Chlamydia psittaci 02DC15
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:chi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CPS0B_1073 (recD)
Enzymes [BR:chi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CPS0B_1073 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1164154..1165668)
Genome map
AA seq 504 aa AA seqDB search
MLSLSPDVSHLLYDVVQQQIVLPLDLAFAKRHISPESKKAFAFLAISSALWRCGYPFLSI
ENERLFPSVSGISEKLFYEYFQALPHDVLSSLFVIENNKIYLKSLYTVREKLFKKLSLLS
QASNRYSLTTTTLSSLSQEQNEVFHKAVNSCFSLICGGPGTGKTFLAVQIIIALIKQYPK
IRIAIVSPTGKATSHIRHILSKHHISESSVTIQTIHRFLQEHAYHQCASFDLLLVDEGSM
VTFSLLHSLVNTLSGENKHGKIIADNLIILGDENQLPPIGVGAGNPLQDLIARFPERALH
LHVSHRAKTNRVQNFARAVLERQAIPFTPLPPLLTALSMIKEAFINTPSSQTQLCVLTPM
RHGPWGYLRLNELLFHEIQKTHPELPIPIMITERYEAWGLFNGDTGYLCPKTQKLFFSHS
RFIDAKEFSYYTYNYAMSVHKSQGSEYEDVIVIIPKGCETFDISILYTAITRAKNNIDVW
ADRETLYKIIKKPHKYTYGVDRLL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgctttcgttaagcccggatgtttctcaccttctttatgatgtagttcaacaacagatt
gttctacctttggacctagcttttgcgaagcgccatatctctccagaatcaaaaaaagcg
tttgcatttctggctatttcttctgctctttggcgttgtggttatccctttcttagtata
gaaaatgagcgtttattcccttcagtatccggaatttctgaaaagctgttttatgaatat
tttcaggctcttcctcacgatgttttgtcgtcgttgtttgtgatagaaaataataaaatt
tatttaaaatctttatatacagttcgtgagaaactttttaaaaaactctctttgttgtca
caagcttctaatcggtacagcctgactacaacaactctgtcgagtttatctcaggagcaa
aatgaggtttttcacaaagctgttaacagttgtttttctttgatctgtggtgggccggga
acagggaagacatttcttgctgtacagataatcatcgcgttaattaagcagtatcctaaa
atccgtattgctatagtctctcctacaggaaaagcaacctctcatatccgtcacatactc
tctaaacatcatatttctgagtctagtgtcacaatccaaacaatacaccgattcttgcaa
gaacatgcgtatcaccagtgcgcttcttttgatttattattagttgatgaggggtctatg
gtgacatttagtcttctgcatagcctagtcaacactttatcaggggaaaataaacacggg
aaaatcattgctgataatttaattatattgggagatgagaatcagctcccccccataggt
gttggcgccggaaatcctcttcaagatttgatagcacgtttccctgaaagagctctacat
cttcatgtttctcacagagctaaaacaaatagagttcaaaattttgctagagctgtttta
gaaagacaagccattccttttacccctttgcctcctttgctcactgcactttctatgatt
aaagaggcgtttataaataccccctcatctcaaacacaattgtgtgttttaactcctatg
cgacatggtccttggggatacctacgcttaaatgaactgctctttcatgaaatacaaaaa
acacatccagagttacccattcctattatgataacagaacgttatgaagcttgggggcta
tttaatggtgatacggggtacctttgcccaaagacgcaaaagttatttttttctcactct
cgctttatcgatgccaaagagttttcttattatacctataactacgctatgtcagtgcat
aaaagtcagggaagtgagtacgaggacgtcattgttattatccctaaagggtgtgaaact
tttgacatttctattctttacacagcgatcacacgtgcaaagaacaacatagatgtgtgg
gctgatcgagagacgttgtataagatcataaaaaaaccccataagtatacttatggggta
gatcgtcttctttag

DBGET integrated database retrieval system