KEGG   Chloroflexus sp. Y-400-fl: Chy400_0003Help
Entry
Chy400_0003       CDS       T00859                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Chy400_0003
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Chy400_0003
   00620 Pyruvate metabolism
    Chy400_0003
   00640 Propanoate metabolism
    Chy400_0003
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Chy400_0003
   00680 Methane metabolism
    Chy400_0003
Enzymes [BR:chl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Chy400_0003
Lipid biosynthesis proteins [BR:chl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Chy400_0003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4020..5954
Genome map
AA seq 644 aa AA seqDB search
MTETRDVALPDTSELYYPDPALVEQSNVMAYARSKGFNSYDELYQWTISHREEFWADMAS
QLEWFKPWDKVLDDSNKPFYQWFVGGKTNIVYNAIDRHLKTWRKNKLALIWEGEDGSQRT
YSYYQLNYEVSRIANVLKSMGVKKGDIVTIYMPRIPELMFSMLACAKIGAAHSVVYGGFS
EAALADRLADAKSKVLITADGGYMRGKVVELKKIVNEALSRTPTVQTCLVFRHTNHGAPM
EQGRDFWMHDLLGLPIANGHCPTEEMDAEDMLFILYTSGTTGKPKGVVHTHGGYMVGTYT
TLKFVFDIKDEDRYWCAADPGWITGHSFIVYAPLINGATSFMYEGAPNYPYPDRWWSMVA
KHGITILYTAPTAIRGLMRFGDLWPSRHDLSTLRLLGSVGEPINPEAWKWFYEKIGHGRC
PIMDTWWQTETGHFMITPTPAVPLKPGSATRPFLGIEADVVHEDGSPCAPDEDGLLVIKN
PWPGMMRTILNDPQRYVEGYWQKVPPYYAAGDSARKDKDGYIWVIGRLDDVIKVSGYRLG
TAEVESALVSHPAVAEAAAIGLPHEVKGNAIHAFVILRAGYEPSHDLEEKLRAHVGHELG
PIARPDSITFVTSLPKTRSGKIMRRVLRARALGLPEGDVSTLEE
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagactcgcgatgtggcgctgcctgacaccagtgaattgtattaccccgatccg
gcgctggttgagcaatccaatgtgatggcgtatgcccgtagcaaaggcttcaattcctac
gatgagctgtatcagtggacgatcagccatcgtgaggagttttgggccgatatggccagc
cagctcgaatggttcaagccatgggacaaggtgctcgacgatagcaacaagcctttctat
cagtggtttgtgggcgggaagacaaacatcgtttacaacgcgattgatcgccatctcaaa
acctggcgcaagaataagcttgccctgatttgggaaggtgaagatggcagtcagcgcacc
tattcgtactaccagctcaactacgaagtatcacgtattgcgaatgtgctcaagagcatg
ggggtaaagaaaggggacattgttaccatttatatgccccgcatccctgagttgatgttc
agcatgctggcctgtgcgaaaatcggtgctgcccacagcgttgtatacggtggcttctcg
gaagcggccctcgccgaccgcctggccgacgcgaagagcaaagtgctgatcactgctgac
ggtggctacatgcgcggcaaagtggtcgagctgaagaagatcgtcaacgaggcgctgtcg
cgcacgccgactgttcaaacctgtctggtcttccgccacaccaaccacggtgccccgatg
gagcagggccgtgacttctggatgcacgatctgctcggcctgccaatcgcgaacggtcat
tgccccaccgaagagatggacgcggaggatatgctctttatcctctacacgtcggggacg
accggcaagcccaagggggttgtccatacccacggtgggtacatggtcggtacgtacacg
accctgaagtttgtctttgatattaaggacgaagaccgttactggtgcgccgccgatcca
ggctggatcaccggtcactcgttcattgtgtatgcaccgctgatcaatggcgcgacatcg
tttatgtacgagggtgctcccaattatccctatcccgaccgctggtggagcatggttgcc
aaacacgggattacgatcctctacaccgctcctaccgccattcgcggtctgatgcggttc
ggcgacctctggccgtcacgccacgatctgagtaccttgcgcctgctcggttcggtcggt
gaaccgattaaccccgaagcgtggaagtggttctacgagaagatcggtcatggccgctgc
ccgattatggatacctggtggcagactgaaaccggtcactttatgattacgccgacaccc
gccgtgccactcaagcccggctcggcgactcgacctttccttggtatcgaagctgatgtt
gtgcatgaggacggttcaccctgcgcaccggatgaggacgggttgctagtgatcaaaaac
ccgtggcccggtatgatgcgcacgatattgaatgatccacagcgctacgtagaaggctac
tggcagaaggtgcccccctactacgccgccggcgacagtgcccgtaaagacaaggatggc
tacatctgggtcattggccggttggacgacgtgattaaggtgtcaggctatcgcctcggt
accgccgaagtcgagagtgcgctggtcagccacccggcagtggccgaagcggctgcgatt
ggtctgccgcacgaagtgaagggcaatgccattcacgccttcgtgatcctgcgcgccggc
tacgaaccgagccacgacctcgaagagaagctgcgggcacacgttggtcacgaactcggc
ccaattgcccgtcccgactcgatcacgtttgtgacatcgctgcccaagacgcgctccggc
aagattatgcgccgcgtcttgcgcgcccgtgccctcggtctgcccgaaggcgatgtctca
acgcttgaggagtaa

DBGET integrated database retrieval system