KEGG   Chloroflexus sp. Y-400-fl: Chy400_0003Help
Entry
Chy400_0003       CDS       T00859                                 

Definition
(RefSeq) acetate/CoA ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Chy400_0003
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Chy400_0003
   00620 Pyruvate metabolism
    Chy400_0003
   00640 Propanoate metabolism
    Chy400_0003
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Chy400_0003
   00680 Methane metabolism
    Chy400_0003
Enzymes [BR:chl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Chy400_0003
Lipid biosynthesis proteins [BR:chl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Chy400_0003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
4020..5954
Genome map
AA seq 644 aa AA seqDB search
MTETRDVALPDTSELYYPDPALVEQSNVMAYARSKGFNSYDELYQWTISHREEFWADMAS
QLEWFKPWDKVLDDSNKPFYQWFVGGKTNIVYNAIDRHLKTWRKNKLALIWEGEDGSQRT
YSYYQLNYEVSRIANVLKSMGVKKGDIVTIYMPRIPELMFSMLACAKIGAAHSVVYGGFS
EAALADRLADAKSKVLITADGGYMRGKVVELKKIVNEALSRTPTVQTCLVFRHTNHGAPM
EQGRDFWMHDLLGLPIANGHCPTEEMDAEDMLFILYTSGTTGKPKGVVHTHGGYMVGTYT
TLKFVFDIKDEDRYWCAADPGWITGHSFIVYAPLINGATSFMYEGAPNYPYPDRWWSMVA
KHGITILYTAPTAIRGLMRFGDLWPSRHDLSTLRLLGSVGEPINPEAWKWFYEKIGHGRC
PIMDTWWQTETGHFMITPTPAVPLKPGSATRPFLGIEADVVHEDGSPCAPDEDGLLVIKN
PWPGMMRTILNDPQRYVEGYWQKVPPYYAAGDSARKDKDGYIWVIGRLDDVIKVSGYRLG
TAEVESALVSHPAVAEAAAIGLPHEVKGNAIHAFVILRAGYEPSHDLEEKLRAHVGHELG
PIARPDSITFVTSLPKTRSGKIMRRVLRARALGLPEGDVSTLEE
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagactcgcgatgtggcgctgcctgacaccagtgaattgtattaccccgatccg
gcgctggttgagcaatccaatgtgatggcgtatgcccgtagcaaaggcttcaattcctac
gatgagctgtatcagtggacgatcagccatcgtgaggagttttgggccgatatggccagc
cagctcgaatggttcaagccatgggacaaggtgctcgacgatagcaacaagcctttctat
cagtggtttgtgggcgggaagacaaacatcgtttacaacgcgattgatcgccatctcaaa
acctggcgcaagaataagcttgccctgatttgggaaggtgaagatggcagtcagcgcacc
tattcgtactaccagctcaactacgaagtatcacgtattgcgaatgtgctcaagagcatg
ggggtaaagaaaggggacattgttaccatttatatgccccgcatccctgagttgatgttc
agcatgctggcctgtgcgaaaatcggtgctgcccacagcgttgtatacggtggcttctcg
gaagcggccctcgccgaccgcctggccgacgcgaagagcaaagtgctgatcactgctgac
ggtggctacatgcgcggcaaagtggtcgagctgaagaagatcgtcaacgaggcgctgtcg
cgcacgccgactgttcaaacctgtctggtcttccgccacaccaaccacggtgccccgatg
gagcagggccgtgacttctggatgcacgatctgctcggcctgccaatcgcgaacggtcat
tgccccaccgaagagatggacgcggaggatatgctctttatcctctacacgtcggggacg
accggcaagcccaagggggttgtccatacccacggtgggtacatggtcggtacgtacacg
accctgaagtttgtctttgatattaaggacgaagaccgttactggtgcgccgccgatcca
ggctggatcaccggtcactcgttcattgtgtatgcaccgctgatcaatggcgcgacatcg
tttatgtacgagggtgctcccaattatccctatcccgaccgctggtggagcatggttgcc
aaacacgggattacgatcctctacaccgctcctaccgccattcgcggtctgatgcggttc
ggcgacctctggccgtcacgccacgatctgagtaccttgcgcctgctcggttcggtcggt
gaaccgattaaccccgaagcgtggaagtggttctacgagaagatcggtcatggccgctgc
ccgattatggatacctggtggcagactgaaaccggtcactttatgattacgccgacaccc
gccgtgccactcaagcccggctcggcgactcgacctttccttggtatcgaagctgatgtt
gtgcatgaggacggttcaccctgcgcaccggatgaggacgggttgctagtgatcaaaaac
ccgtggcccggtatgatgcgcacgatattgaatgatccacagcgctacgtagaaggctac
tggcagaaggtgcccccctactacgccgccggcgacagtgcccgtaaagacaaggatggc
tacatctgggtcattggccggttggacgacgtgattaaggtgtcaggctatcgcctcggt
accgccgaagtcgagagtgcgctggtcagccacccggcagtggccgaagcggctgcgatt
ggtctgccgcacgaagtgaagggcaatgccattcacgccttcgtgatcctgcgcgccggc
tacgaaccgagccacgacctcgaagagaagctgcgggcacacgttggtcacgaactcggc
ccaattgcccgtcccgactcgatcacgtttgtgacatcgctgcccaagacgcgctccggc
aagattatgcgccgcgtcttgcgcgcccgtgccctcggtctgcccgaaggcgatgtctca
acgcttgaggagtaa

DBGET integrated database retrieval system