KEGG   Chloroflexus sp. Y-400-fl: Chy400_0108Help
Entry
Chy400_0108       CDS       T00859                                 

Definition
(RefSeq) enoyl-CoA hydratase/isomerase
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Chy400_0108
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Chy400_0108
   00650 Butanoate metabolism
    Chy400_0108
  Lipid metabolism
   00071 Fatty acid degradation
    Chy400_0108
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Chy400_0108
   00310 Lysine degradation
    Chy400_0108
   00360 Phenylalanine metabolism
    Chy400_0108
   00380 Tryptophan metabolism
    Chy400_0108
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Chy400_0108
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Chy400_0108
   00281 Geraniol degradation
    Chy400_0108
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Chy400_0108
   00627 Aminobenzoate degradation
    Chy400_0108
   00930 Caprolactam degradation
    Chy400_0108
Enzymes [BR:chl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Chy400_0108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
135384..136160
Genome map
AA seq 258 aa AA seqDB search
MSEESLVLSTIEGPIAILTLNRPQALNALSPALIDDLIRHLEACDADDTIRVIIITGAGR
AFAAGADIKAMANATPIDMLTSGMIARWARIAAVRKPVIAAVNGYALGGGCELAMMCDII
IASENAQFGQPEINLGIIPGAGGTQRLTRALGPYRAMELILTGATISAQEALAHGLVCRV
CPPESLLDEARRIAQTIATKSPLAVQLAKEAVRMAAETTVREGLAIELRNFYLLFASADQ
KEGMQAFIEKRAPNFSGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagagtctctggttctcagcacaattgaaggccccatcgccatcctcaccctc
aatcgcccccaggccctcaatgcgctcagtccggccttgattgatgacctcattcgccat
ttagaagcctgcgatgccgatgacacaatccgcgtgatcattatcaccggcgccggacgg
gcatttgctgccggcgctgacatcaaagcgatggccaatgccacgcctattgatatgctc
accagtggcatgattgcgcgctgggcacgcatcgccgcggtgcgcaaaccggtgattgct
gccgtgaatgggtatgcgctcggtggtggttgtgaattggcaatgatgtgcgacatcatc
atcgccagtgaaaacgcgcagttcggacaaccggaaatcaatctgggcatcattcccggt
gctggtggcacccaacggctgacccgcgcccttggcccgtatcgcgcaatggaattgatc
ctgaccggcgcgaccatcagtgctcaggaagctctcgcccacggcctggtgtgccgggtc
tgcccgcctgaaagcctgctcgatgaagcccgtcggatcgcgcaaaccattgccaccaaa
tcaccactggctgtacagttggcgaaagaggcagtccgtatggccgccgaaaccactgtg
cgcgaggggttggctatcgagctgcgtaacttctatctgctgtttgccagtgctgaccaa
aaagaggggatgcaggcatttatcgagaaacgcgctcccaacttcagtggtcgttga

DBGET integrated database retrieval system