KEGG   Chloroflexus sp. Y-400-fl: Chy400_0274Help
Entry
Chy400_0274       CDS       T00859                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
chl00010  Glycolysis / Gluconeogenesis
chl00030  Pentose phosphate pathway
chl00051  Fructose and mannose metabolism
chl00052  Galactose metabolism
chl00680  Methane metabolism
chl01100  Metabolic pathways
chl01110  Biosynthesis of secondary metabolites
chl01120  Microbial metabolism in diverse environments
chl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Chy400_0274
   00030 Pentose phosphate pathway
    Chy400_0274
   00051 Fructose and mannose metabolism
    Chy400_0274
   00052 Galactose metabolism
    Chy400_0274
  Energy metabolism
   00680 Methane metabolism
    Chy400_0274
Enzymes [BR:chl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Chy400_0274
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Chy400_0274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ACM51713
UniProt: B9LHK4
Position
complement(330129..331199)
Genome map
AA seq 356 aa AA seqDB search
MASKKQRIGVLTSGGDAPGLNAVIRAVVKSASGLGWEVIGIHDGFEGLLGTKSYRVLTNA
DVQGLLPRGGTILRTTNKGHFGPRRSDELSEADPYVRAVKAIEEMGLRALITIGGEGTQR
IALELHKLGAPVIGVPKTIDNDLAGTDRTFGFDTALQVATDAIDRLHTTAASHNRVMVLE
VMGRHTGWIALHAGLAGGADVILIPEIPFSIERVAEKVMARDQQGSSFSIIVVAEGARPR
GGSEMYIAEGRLGGIGHWVGEQLEKLTAKEVRVVVLGHLQRGGSPSPYDRLLSTRYGAAA
VQAAARGIYGEMVALRGQDIVTVPLAEACGHLNRVRPHSDLVLCARSLGIAFGDEL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcaaaaagcagcggatcggcgtgcttaccagtggcggtgacgcgccaggactc
aatgccgtcatccgtgcagtcgtcaagtcggcgtccggtctgggttgggaagtgatcggt
attcacgatggttttgagggtttattagggacaaagagctaccgggtacttaccaatgct
gatgtacagggattattgccgcggggtggcacaatcctgcgcacaaccaacaaggggcat
tttggcccacgccggagcgatgagctgtcagaggccgatccgtatgttcgtgcggtaaag
gcgattgaggagatggggctgcgggccttgatcactattggtggtgaggggacgcagcgg
attgctcttgaactgcataaattgggtgcaccggtgatcggcgtaccgaaaacgattgat
aacgatcttgccggaactgatcgtacattcggtttcgatacagcgttgcaggtagcaacc
gatgcgattgatcggttacacaccactgctgccagccataatcgcgtcatggtgttggaa
gttatgggccggcataccggttggatcgctctccacgccggtctggctggtggtgcagat
gtcatcttgattccggaaattccattttcgattgagcgagtcgccgagaaggttatggcg
cgtgaccagcagggtagctcgttcagcatcatcgttgtggctgaaggtgcccgccctcgt
ggtggtagcgagatgtatatcgccgaaggccggttgggtggaattggtcactgggttggt
gaacagctcgaaaagctgaccgccaaagaggttcgggttgtcgttttgggacatttacag
cgtggtggttcgccatcgccttatgatcgcctgctttcgacccgctatggtgcagcagca
gtgcaggcggcagctcgtggcatctatggcgaaatggtggctctccgcgggcaagacatt
gtaacggtgccgttggccgaagcctgcggccacctgaatcgggtacgtcctcacagcgac
ctggtgctctgtgcacggagtttggggattgcctttggcgatgaactctga

DBGET integrated database retrieval system