KEGG   Chloroflexus sp. Y-400-fl: Chy400_0557Help
Entry
Chy400_0557       CDS       T00859                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:chl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Chy400_0557 (recR)
DNA repair and recombination proteins [BR:chl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Chy400_0557 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(664040..664654)
Genome map
AA seq 204 aa AA seqDB search
MTVRTDQLIAAPVARLIEEFAKLPGIGPKTASRLTFYLLRAEPKQALALAQAILDVKEQV
GYCRRCFNITVGELCAICLDPSRDQTKICVVEEPLDVLAIERTGAYRGLYHVLHGHIAPL
EGIYREDLKIEELLARVRSEPVQEVILATNPNTEGEATAFLLLRDLAPLGVRVTRPARGL
PTGGDLEWADPETLGSAFEGRREL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttcgcacggatcaattgattgccgcaccggtggctcgtctaatcgaggaattt
gccaaactgcccggtatcggcccaaagacggcgtcacgtctgaccttttatctcttacgg
gctgaaccaaaacaggcgctggcgctggcgcaagctattctcgatgtgaaagaacaggtt
ggctactgccgacgctgttttaacatcaccgtgggtgagctgtgtgcaatttgtctcgat
ccgtcgcgcgatcaaaccaaaatctgtgtggttgaagagccgctcgatgtgctggctatc
gagcgcaccggtgcctaccgcggtctgtatcatgtcctccacggccacattgctccgctc
gaaggtatctatcgcgaagatctcaagattgaagagctactcgcgcgggttcgctccgaa
cctgttcaggaagtgatccttgccacaaaccccaataccgagggtgaggccaccgccttt
ctgctgcttcgcgacctcgcacctcttggtgtacgggtgacccggccagcacgggggttg
ccgaccggtggcgatctcgaatgggccgatccggaaacgcttggctccgcctttgaagga
cgacgtgagttgtaa

DBGET integrated database retrieval system