KEGG   Chloroflexus sp. Y-400-fl: Chy400_0637Help
Entry
Chy400_0637       CDS       T00859                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Chy400_0637
Enzymes [BR:chl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Chy400_0637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(784319..784996)
Genome map
AA seq 225 aa AA seqDB search
MTTDLPLDVETALRAEMVLCGRLLYERGLVVAGDGNLSARLPDDTILITPAGLAKGMLTV
DDLLVIDLDGRLVRGAPGRQPSSERYLHLFVYRHRPDIMACIHAHPPTAVGATLAGVSLA
EPLLPEALIALGPIPTAPYALTGTTEMGAAIEPFVADHEAILLAYHGAVTYGTTLLQAFH
RMEQIEHCARTLLAAHLFGGARPLPPERLAELQEVRRAFRAAGRI
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccgatcttcctcttgatgttgaaacggcattacgtgccgaaatggttctttgt
ggtcgtttactctacgaacgtgggctggtggttgccggcgacggtaatctctcggcacgc
ctgccagatgacaccatcctgattacccctgccggcctggctaaggggatgttgacggtt
gacgatctactcgtcattgacctcgatggtcgattggtgcgtggtgcaccgggccgccaa
ccgtcatcagagcgctatctccatctctttgtctatcgtcatcggcccgacatcatggcg
tgtattcacgcccatccgcctacagcggtcggagcaaccctggcaggtgtcagtctggcc
gagccattattgccggaagcgctgattgcccttggcccgatcccaactgccccatacgca
ctgaccggtacgaccgagatgggggcagctattgagccatttgttgccgatcatgaagcg
atcttgcttgcctatcacggtgccgtaacatacggcacaacattactgcaagcctttcac
cgtatggagcagattgaacactgcgcacgcacgttgctggcagctcatctgtttggggga
gcacgtcctttgccgccagaacgactcgccgaattgcaggaagtgcgacgtgcctttcgc
gctgctggtcggatttaa

DBGET integrated database retrieval system