KEGG   Chloroflexus sp. Y-400-fl: Chy400_0695Help
Entry
Chy400_0695       CDS       T00859                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Chy400_0695
Enzymes [BR:chl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Chy400_0695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
866583..868007
Genome map
AA seq 474 aa AA seqDB search
MMAGYDSVVIGGGIAGLAAAYTLHKRGYRVLVIESTNRVGGVIQTITTPEGYILDCGPNT
VGTGDARLWQELIDLGLRERITPAAPCSKRRFILINGTPVEIPTSPVGLITTRLLSWRGK
LRVLAEPFINRGSTDPDESVAAFFTRRIGAEATAHLLDPFVAGVYAGDPQRLSTAAVFPS
LWEAAQRSGSIVRGMLSKPKPKTQVSEPKMRSRTFTFRGGLAEWPRALAQALGAGNVWTE
RRVVKLQPRDSWWEVTIDGVNGPETLISRSLIIATPAFTAADLIESVDQRAAGALRGIPY
APVAVVHLGFRRDQISQELSGFGVLAPSSEQRQFLGILWTSSIFPHVAPHDHVLTTTLSG
GAIRPELAERSDETLIEAAIRDHHQLLGIRGQPIFTHVTRWRTAIAQYTFGHRERIATLV
QLEQRLPTIQFAGSYRDGVGVPKTWASGVQAGERIAAALAAHGTTAVSTETASG
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgatggcgggatacgacagtgtagtgattggcggtggcattgccggtttagctgcggct
tacacgctccacaagcgtggttatcgggtcctggtcatcgagtcgaccaatcgcgttggc
ggtgtgatccagaccatcaccacaccagaaggctacattctcgattgtgggccgaacacg
gtgggtaccggcgatgcgcgattgtggcaggaactgatcgatctgggtctgcgcgagcgg
atcacaccggcagcgccatgtagcaaacggcggttcatcctgatcaatggtacaccggtt
gaaatcccaacctcaccagtcgggctgattaccacgcgattactctcgtggcgggggaaa
ttgcgggtactggccgaaccgttcatcaaccgtggatcgaccgatcccgatgaaagcgtt
gctgccttcttcacccgccggattggtgcagaggctaccgcccacctcctcgatccattt
gttgccggcgtctacgctggcgatccgcaacggctctcgactgcggcagtctttccatca
ctgtgggaagcggcccagcgcagtggcagcatcgtgcgcggcatgctgagcaaacccaaa
ccgaagactcaggtgagtgagccaaagatgcgcagccgcacctttaccttccgcggtggc
ctggccgaatggccacgcgctctggcgcaagccctgggtgccggcaatgtctggacagaa
cggcgcgtggtcaagctccaaccacgcgactcctggtgggaagtgacgattgatggtgtg
aacggcccggagacactcatcagtcgcagcctcattatcgccaccccagcctttacggcg
gctgatctcattgagtcggttgatcaaagagcggctggtgccctacgcggcattccgtat
gcgccggtagcagtggtacatctcggctttcgtcgtgaccagatcagccaggaattgagc
ggctttggtgtgctggccccctcaagcgaacagcgtcagttcctcggcattctctggaca
tcaagcatcttcccgcacgttgcaccacacgatcatgtcctcaccacaaccctcagtggt
ggtgctatccggcccgaactggccgaacggagtgacgaaacactgattgaagcggccatt
cgcgatcatcaccagctcctggggatcagagggcaaccgatcttcacccatgttactcgc
tggcgaaccgccattgcccagtatacctttgggcaccgcgagcggattgccaccctcgtg
caactcgaacagcgcctgccgaccatccagtttgccggcagctaccgcgacggcgttgga
gtgcccaaaacctgggccagcggtgtgcaggcaggcgagcggatcgctgcggcactggca
gcccatggaactaccgcagtttccacagagacggcgtcggggtga

DBGET integrated database retrieval system