KEGG   Chloroflexus sp. Y-400-fl: Chy400_0890Help
Entry
Chy400_0890       CDS       T00859                                 

Definition
helicase, RecD/TraA family
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:chl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Chy400_0890
Enzymes [BR:chl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Chy400_0890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1121638..1123815)
Genome map
AA seq 725 aa AA seqDB search
MQQLDGTLERITFQSESDGYTVAQLRPLGKRHTVTIVGNLPGVQPGEQLSLEGEWRDHPT
HGRQFHVQRYRSRLPATVDGIRRYLGSGLIKGVGPVLAKRITETFGKYTLEVLDREPERL
SEVPGLGRKKAVLIAEAWRAQQRIKDLMLLLQDLGLPTGVAVRIYRHYGDDALRVVQQEP
YRLADEVDGVGFRTADAIAAGLGIARDDPQRIAAGLRYTLAQASDEGHCYLPAGELTRRA
ASLLSVTTAAVTDVFTQMVATNQLWRDPIVADPDPDRYPIYLPPLAFAEIGVANAIRRLI
QQRSSLAARYAPSRWNLVFAHLAERRGINLSDQQRRAVQTALTTPVMLLTGGPGTGKTTS
LRALVMLLQARGYRPLLAAPTGRAARRLSEATGLEARTIHRLLEYGPDGTFRRNAEYPLD
CDLLVIDEASMLDIVLANQLLKAIPAGAHLVIVGDADQLPSVGPGRVLGDVIESGVVPRV
HLDAIFRQAAGSGIAANARRINEGHLPEWGAHDDFYFFAAATPERCAALTVELVVERIPR
RFGFDPRRDIQVLSPTHKGVAGVAALNAALQAALNPPRPGVAEYHSGATIFRVGDRVIQQ
RNDYDRDVYNGDVGEIVAVDPTGPTVMVRFEDGRTIRYNGLDLDDLTLAYALSVHKSQGS
EYPVVVLPLLLSHQPLLQRNLIYTAVTRARQLVVIVGDRRAVEVAIAAANVERRYTGLSI
RLGRT
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagcttgacggcaccctcgaacggatcacctttcagagtgagagcgatggctac
accgtggcccaacttcgtccgcttggcaaacgtcacacggtgacaattgtcggcaacctg
ccgggcgtacagcccggtgaacaactcagtctcgaaggtgaatggcgcgatcacccgacc
catggccggcagtttcacgtccagcgctaccggagccgtctgccagccacggttgatggt
attcgccgctatctgggcagcggcttgatcaagggtgtcgggccggtcctcgccaaacgg
atcactgaaacctttggcaagtacaccttagaggtgctggatcgcgaaccggagcgtctg
agcgaagtccccggtctggggcggaagaaggccgtgctgatcgccgaggcatggcgggcg
cagcagcgtatcaaagacctgatgttactcctgcaggacctgggtctgcctaccggggtt
gccgttcgtatctaccggcattacggcgatgacgctttgcgagtggtgcaacaggaaccg
taccgtctggccgatgaagttgatggggttgggtttcgtaccgctgacgccattgccgcc
ggtctcggcattgcccgcgatgatccgcagcggatcgctgccgggctgcgttatacgctg
gcacaggcttccgacgaagggcattgttacctgcccgccggtgaactgaccagacgcgct
gccagcctgctttcagtgacgactgctgcggtgacggatgtgtttacgcagatggtggca
accaatcagctttggcgcgatccaattgtggccgatcccgaccctgatcgctacccgatc
tacctgccgccgctggcatttgccgagattggggttgccaacgccattcgccgcctgatc
cagcaacgctcgtccctggctgcacgctatgcacctagccgctggaacctggtgtttgcc
catcttgccgaacggcgtgggatcaatctcagcgatcaacagcgccgtgcggtacagacg
gcgctgaccacaccggtcatgttgctcaccggtgggccggggacgggcaaaaccaccagc
ctgcgtgcgctggtcatgcttttacaggccagaggctatcgtccgctgctggcggcaccg
accggacgggcagcccggcgcttgagcgaggcgaccggcctggaagcccgcactattcac
cgtctgcttgaatatggccctgatggaacatttcgccgcaacgccgaatatcccctcgac
tgtgacctcctggtgatcgatgaagccagtatgctcgatattgtgctggccaatcagctc
ctgaaggcgatcccagccggtgcgcatctggtcatcgtgggggatgccgatcaattgccg
agtgttggccctggccgtgtgcttggtgatgtgatcgagagtggggttgtgccgcgggtg
catctcgatgcgatctttcgccaggctgccggcagtgggattgccgccaatgcgcgacgg
atcaacgaaggccaccttcccgaatggggtgcgcacgatgatttctacttctttgcagct
gcaacacccgaacggtgtgcggcgctgaccgtagagctggtggtagaacgcatcccgcgt
cggtttggatttgatcctcgtcgtgatattcaggtgctcagtccaacccacaaaggggtg
gccggagttgcggccctcaatgcagcattgcaggcagcgttgaacccaccgcgccccggt
gtcgccgaataccacagtggcgctaccatctttcgggtaggggatcgcgtcatccagcag
cggaacgattatgatcgggatgtctacaacggtgatgttggtgagattgtcgcggttgat
cccaccgggccaacagttatggtgcgctttgaggatggtcgaaccatccgttacaacggt
ctcgatctcgatgatctcaccctggcttacgccctcagcgtccacaaaagccagggaagt
gaatacccggttgtcgtccttcccctcctgctgtcccatcagccactgctgcaacgtaac
ctgatctacaccgcagtgacccgcgctcgccagcttgtcgtgatcgttggtgatcggcga
gcggttgaggtggcgattgccgcagccaatgttgaacgccgctacaccggcctgagcatt
cggctcggtagaacctga

DBGET integrated database retrieval system