KEGG   Chloroflexus sp. Y-400-fl: Chy400_0918Help
Entry
Chy400_0918       CDS       T00859                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Chy400_0918
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Chy400_0918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1159837..1160388)
Genome map
AA seq 183 aa AA seqDB search
MKQILYWIYALTLLAMLAACGSAAQTPAPAPAPVSEPAASPAQVTASDQAAAASQAGSSG
SSAASSEHVEMPLPPALADTSLSAKGDVNRGKAIFASSCAGCHSTATNMLLGPGLAGLFS
VNGPVLPDGVDYKGMLPNGKERSEANVAEWIRTGGSGSIGFMPPMPISDEQMADLLAYLR
MLE
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagatactctactggatctatgcactgacgttgctggccatgcttgccgcttgc
ggcagtgctgctcagactccagcacctgcgccggccccagtttctgaaccggcagcctca
cctgcccaggtaactgcgtcagatcaggctgctgccgccagtcaggccggttcgtcggga
agttctgctgcttcatctgagcatgtagaaatgccccttccaccggcattagccgatacg
tcactctcggcaaagggtgatgtcaatcgcgggaaggcgatttttgcttcgtcgtgtgca
gggtgtcattctacggctacgaatatgctgcttgggccggggctggccggtctgtttagc
gtcaatgggccagtgttgccggatggggttgactacaaaggtatgttgccgaacggcaag
gagcggagtgaggctaatgtggccgagtggattcggaccggtggatcggggagtatcggt
tttatgccgccgatgcctatttctgatgagcaaatggccgatctactggcatacctgcgc
atgttggagtag

DBGET integrated database retrieval system