KEGG   Chloroflexus sp. Y-400-fl: Chy400_1010Help
Entry
Chy400_1010       CDS       T00859                                 

Definition
ECF subfamily RNA polymerase sigma-24 subunit
Orthology
K03088  
RNA polymerase sigma-70 factor, ECF subfamily
Organism
chl  Chloroflexus sp. Y-400-fl
Brite
Transcription machinery [BR:chl03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     Chy400_1010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1287929..1288531
Genome map
AA seq 200 aa AA seqDB search
MANEEQRLISAAQAGDLDSFNQIVRLYETRVYNLCYRMLGDTDAAADATQDTFISAFRHL
ANFRGGALKSWLLRIATNTCYDVLRTRKRRPSVSLDKEPDDEGNRLDLPDPGASLDELML
QQELSAAIQRGLAELPEDQRIVIILSDIQGLAYEEIAHITGVQLGTVKSRLSRARAKLRD
ILRAGELLPLKFRLDDETTT
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctaatgaagagcaacgactgatcagtgcagcacaagcgggcgatctcgattcgttt
aaccagattgtacggctatacgaaacgcgggtctacaacctttgttatcgtatgttgggc
gataccgatgccgcagccgatgccacccaggacacgtttatctctgctttccgtcatttg
gcgaactttcgcggcggtgcattgaaatcctggctcctccgcattgctaccaacacctgc
tacgatgtactacgtacccggaaacggcgaccatcggtgtcgcttgacaaagagccagat
gatgagggtaatcggcttgatctccctgatccgggcgccagtctcgatgagcttatgttg
cagcaagagttgagtgcagcgatccagcgtggtttggccgaactacctgaagatcagcgc
atcgtgatcatcctcagcgatattcaagggttagcctatgaggagattgcccacattacc
ggtgtgcagttaggaactgtgaaatcgcgattaagtcgggcacgggctaaattgcgcgat
attctccgcgccggggaactcttaccgttaaaatttcgtcttgatgatgaaacaaccacg
taa

DBGET integrated database retrieval system