KEGG   Chloroflexus sp. Y-400-fl: Chy400_1156Help
Entry
Chy400_1156       CDS       T00859                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
chl  Chloroflexus sp. Y-400-fl
Brite
Enzymes [BR:chl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Chy400_1156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1465179..1465964
Genome map
AA seq 261 aa AA seqDB search
MLEPYLLSSGDHACLLIHGFVGDPGEMRDLGDHLAQAGYTVFGMRLPGHTGNPEDLIAVR
WTDWLAAVQAAFDALARRSTAVSVVGFSLGGALAALLAAQRPVHRLVMLATPYRLGGDWR
VDLLGIVRYVTPWFYLLAQADFSSPDLRASIWRRQPGLDLDDPVIQQMLRRSVKVSVAAA
DELRLTLAAARRALPLVRAPTLIMHGRSDTTADPASAAAIMAQIGSTYRELTYWPATGHQ
LLLTGPYRSAIFQRITRFLAR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaaccgtatttgttgtcgagtggtgatcacgcttgcttgctgatccacgggttt
gtcggcgatcccggtgagatgcgcgatctaggcgatcatctggcgcaagccggctatacg
gtatttggtatgcgtctgcccggacataccgggaaccctgaagacctgattgctgtgcgc
tggacggactggctggctgcggtgcaggcggcatttgacgcactcgcccgccggtctact
gctgtctcagtagtgggtttttcattgggtggcgcactggccgcgttgctggcagcacag
cgccctgtgcaccgcctggtgatgctggcaacaccctaccgccttggtggcgactggcgg
gttgatctgttggggattgtccgctacgtgaccccctggttttatctgctggcccaggcc
gatttcagcagccccgatctacgggcatcaatctggcgtcgccagcccggccttgatctc
gacgatccggtcattcaacagatgctacgacgctcggtgaaggtgtcagtcgccgccgct
gatgagttgcggctgactctggcagccgctcgtcgtgcactgccgctggtacgggcacca
accctgattatgcacggtcgcagtgatacaacagccgatccagccagtgccgcagctatc
atggctcagatcggcagtacttaccgtgaactcacatactggccggccaccggtcatcaa
ctgctactcaccgggccgtaccggtcggccatctttcaacggatcacacggtttctcgcc
cgctag

DBGET integrated database retrieval system