KEGG   Chloroflexus sp. Y-400-fl: Chy400_1215Help
Entry
Chy400_1215       CDS       T00859                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Chy400_1215
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Chy400_1215
Enzymes [BR:chl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Chy400_1215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1549963..1551510
Genome map
AA seq 515 aa AA seqDB search
MNALSEQLLIWFAGDEVPSHLPDLIFNHRVAGVTLYRHLNGASPARIRALTAHLQQLAAA
SGYGPLLIGADQEGGQLQALPGLTAFPGAMALGATQSPALAFRVGSAIGAELAALGVNLV
YAPVCDVNTNPQNPVIGIRAFGDDPKIVGVLAAAMIAGLQQHGVAATAKHFPGHGDTFGD
SHYGLVRVNHDYERLQHVEWLPFSAAIEAGVQAVMVGHLAVPALQAADRPATRAPQVIAH
LRHHLGFRGVTISDALDMKAFAPDDGYARALSEAVHAGIDLLLLGAGNDLEQTIKFLSTI
DRNTKSTISSQRIAALRQWLRNRPQPDLSVVGCAAHHALADEVAQRALTLVRNQEGLLPL
QLSTTARVVVIMPQPVDLTPADTSASERPALAEAILSCHSYVQSFIIDIDPSPASIADIL
AALAEADLVIIGTINAQTYRGQASLVHEIFQRGIPLITVALRLPTDLLAYPEVSTHLCTY
SLQPVALKALAAGLWGEIPFQGKLPLRVLSEEFNV
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcattgagtgaacaactactaatctggttcgccggtgatgaagtaccatcacat
ctgccggacctgatcttcaaccatcgcgttgccggtgtgacgctctatcgccacctcaat
ggcgcatcaccagcccgtatccgtgcattaaccgcgcatttacagcaactggcagcagcc
tcgggctacggtcctctcttaatcggtgccgatcaggagggtggtcaattgcaagcctta
ccgggattaaccgcttttcccggtgcaatggcattaggagcaacccaatcgccagctttg
gcctttcgtgttggcagtgcaatcggggcggaactggcagcacttggggttaacctggtc
tatgccccggtttgtgatgttaatacgaacccacaaaacccggtcatcgggatccgtgcc
tttggcgatgaccccaagatcgtcggagtactggctgcggcaatgattgccggcctgcag
cagcatggagttgccgcaacagccaagcactttcccggccacggagatacgtttggtgat
agtcattatggtctggttagggttaatcacgattacgaacgattacagcacgtagaatgg
ttgccattttcggcggctatcgaggctggtgttcaggcagtgatggttggacatctggct
gtacctgcattgcaggcagcggatcgccctgccacccgcgcaccacaggtcatagcgcat
ctgcggcatcacctcggattcagaggtgttacgattagcgatgcactcgacatgaaagcc
tttgcacctgacgatggatatgccagagctttgtcggaagcagttcatgcaggtatcgat
ctgctcttgctcggtgcaggaaatgatctggagcagacaataaagtttctcagtacaatt
gatagaaacactaaaagtactatttccagccagcgcattgcggcgctgcgccaatggctg
cggaatcgtcctcaaccagatctatcagttgtcggatgtgcagctcatcacgcgctggca
gatgaggtggcgcagcgcgcattaaccctggtgcgcaatcaggaaggcttattaccacta
caattatcaacaacagcccgtgtcgtggtaatcatgccgcaacccgttgatcttacccct
gccgacacatcagcaagtgaacggcctgcacttgccgaggcgatcctttcttgccattct
tatgttcagtccttcattatcgatattgatccctctccagccagcattgccgatattcta
gctgctctcgccgaagccgatctggtgatcataggaacaatcaacgcccaaacgtatcgt
ggtcaggcttcgctcgtacacgagatctttcaaagaggcattcccctgattaccgtagca
ttacgtctccccaccgatttgctcgcctacccggaagtgtcaacgcatctctgtacttat
agtttgcaaccggtagccttgaaagcacttgctgctggcctatggggtgaaattccattc
cagggtaagctaccattacgagtattgtctgaggaatttaatgtatga

DBGET integrated database retrieval system