KEGG   Chloroflexus sp. Y-400-fl: Chy400_1218Help
Entry
Chy400_1218       CDS       T00859                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
chl  Chloroflexus sp. Y-400-fl
Pathway
chl00010  Glycolysis / Gluconeogenesis
chl00071  Fatty acid degradation
chl00350  Tyrosine metabolism
chl00625  Chloroalkane and chloroalkene degradation
chl00626  Naphthalene degradation
chl01100  Metabolic pathways
chl01110  Biosynthesis of secondary metabolites
chl01120  Microbial metabolism in diverse environments
chl01130  Biosynthesis of antibiotics
chl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:chl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Chy400_1218
  Lipid metabolism
   00071 Fatty acid degradation
    Chy400_1218
  Amino acid metabolism
   00350 Tyrosine metabolism
    Chy400_1218
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Chy400_1218
   00626 Naphthalene degradation
    Chy400_1218
Enzymes [BR:chl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Chy400_1218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N 2-Hacid_dh_C UDPG_MGDP_dh_N Methyltransf_25 Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: ACM52639
Position
1553589..1554635
Genome map
AA seq 348 aa AA seqDB search
MRAVYYEAFGQMPWIATLPDPAPTPDGVVLAVRATGLCRSDWHGWMGHDPDIKLPHVPGH
ELAGEIVAVGSQVRRWRIGDRVTVPFVCACGFCPQCQAGQQQVCDNQFQPGFTHWGSFAE
YVAIDRADLNLVRLPADMSFTTAASLGCRFATAFRAVVDLGQVRGGEWVAVYGCGGVGLS
AIMLASALGGQVIGIDINLERLALARAVGATAVIDATTEPDVVSVVRDLSRGGVHLAIDA
LGSPMTCANAIASLRKRGRHVQVGLLLADQRMPPLPMDIVVARELTIMGSHGMQAYRYDA
MLDLIQSGKVQPQRLIGRTISLSEAPAALVDLDSFRGSGVTVITEFQG
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgtctattatgaagcgtttggtcagatgccatggatcgccacgctgcccgat
ccagccccaacgccagatggtgtcgtgctcgcagtacgcgctaccggcctgtgtcgtagc
gactggcatggctggatggggcatgatcccgatattaagctgccgcatgtgccaggccac
gaactggccggcgagattgttgccgtcggatcacaggttcggcgctggcgaatcggtgat
cgggtcactgttcccttcgtgtgtgcctgtggtttttgccctcagtgtcaggccggtcag
caacaggtgtgtgacaaccagtttcaaccgggattcacgcattggggatcgtttgctgaa
tacgttgccattgatcgcgccgatctgaatctggtgcgcttgcctgccgatatgagcttc
acgactgccgccagtctggggtgtcgttttgcaactgcctttcgcgccgtcgttgatttg
ggccaggtacgtggaggcgagtgggtggcggtttacgggtgtggtggcgttggtctctcg
gcgattatgttagcctctgccctcggtggacaggtgatcggaatcgatattaacctggaa
cggctggcactggctcgggcggtaggggcaacggcggtgattgatgccactaccgaaccg
gatgtggtaagcgtggttcgcgatctcagccgcggtggggtacacctcgcgattgatgcg
ttgggtagtcctatgacctgcgccaatgccattgccagtctgcggaagcgcgggcgccat
gtgcaggttggtctgctgctggccgaccaacggatgcctccgttgccgatggatatcgtg
gttgcgcgtgagttgacgattatgggaagccatgggatgcaggcttaccgctatgatgcg
atgctcgacctcatccagtctggcaaagtacaaccgcagcgcctgattggccgcacgatt
agcctgagtgaagcaccggcggcgctggtcgatctcgatagtttccgtggttctggggtg
acggtgattacagagtttcagggttag

DBGET integrated database retrieval system